Details of Protein

General Information of Protein (ID: PRT00917)
Name	Sulfatase sulf-1 (SULF1)
Synonyms	Click to Show/Hide Synonyms of This Protein hSulf-1; SULF1; KIAA1077
Gene Name	SULF1	Gene ID	23213
UniProt ID	Q8IWU6
Family	Hydrolases (EC 3)
EC Number	EC: 3.1.6.- (Click to Show/Hide the Complete EC Tree) Hydrolases Ester bond hydrolase Sulfuric ester hydrolase EC: 3.1.6.-
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSL QVMNKTRKIMEHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAM HEPRTFAVYLNNTGYRTAFFGKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKE KHGFDYAKDYFTDLITNESINYFKMSKRMYPHRPVMMVISHAAPHGPEDSAPQFSKLYPN ASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNILQRKRLQTLMSVDDSVERLYNML VETGELENTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSVEPGSIVPQIVL NIDLAPTILDIAGLDTPPDVDGKSVLKLLDPEKPGNRFRTNKKAKIWRDTFLVERGKFLR KKEESSKNIQQSNHLPKYERVKELCQQARYQTACEQPGQKWQCIEDTSGKLRIHKCKGPS DLLTVRQSTRNLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHT RQTRSLSVEFEGEIYDINLEEEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLA DSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQDKIKNL REVRGHLKRRKPEECSCSKQSYYNKEKGVKKQEKLKSHLHPFKEAAQEVDSKLQLFKENN RRRKKERKEKRRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTSSNNNTYWCLR TVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQ CNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Function	Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. Diminishes HSPG (heparan sulfate proteoglycans) sulfation, inhibits signaling by heparin-dependent growth factors, diminishes proliferation, and facilitates apoptosis in response to exogenous stimulation.
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulated by This Protein
Nucleosides, nucleotides, and analogues
3'-AMP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3'-AMP concentration: decrease (FC = 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 3'-AMP levels compared with control group.
5'-Methylthioadenosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	5'-Methylthioadenosine concentration: decrease (FC = 0.71)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 5'-methylthioadenosine levels compared with control group.
5-Thymidylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	5-Thymidylic acid concentration: decrease (FC = 0.50 / 0.83)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 5-thymidylic acid levels compared with control group.
Adenosine monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Adenosine monophosphate concentration: increase (FC = 1.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of adenosine monophosphate levels compared with control group.
ADP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	ADP concentration: increase (FC = 1.60 / 1.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of ADP levels compared with control group.
ATP		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	ATP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of ATP levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Overexpression of SULF1
Induced Change	ATP concentration: decrease (FC = 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that overexpression of SULF1 leads to the decrease of ATP levels compared with control group.
Coenzyme A		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Coenzyme A concentration: decrease (FC = 0.52 / 0.68)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of coenzyme A levels compared with control group.
Cytidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cytidine concentration: decrease (FC = 0.16 / 0.21)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of cytidine levels compared with control group.
Cytidine monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cytidine monophosphate concentration: decrease (FC = 0.62 / 0.76)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of cytidine monophosphate levels compared with control group.
Deoxyguanosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Deoxyguanosine concentration: increase (FC = 1.56)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of deoxyguanosine levels compared with control group.
Deoxyinosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Deoxyinosine concentration: increase (FC = 1.36)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of deoxyinosine levels compared with control group.
Dephospho-CoA		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Dephospho-CoA concentration: decrease (FC = 0.32 / 0.55)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of dephospho-CoA levels compared with control group.
FAD		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	FAD concentration: increase (FC = 1.83 - 1.89)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of FAD levels compared with control group.
FMNH2		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	FMNH2 concentration: increase (FC = 1.63 / 1.64)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of FMNH2 levels compared with control group.
Guanosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Guanosine concentration: increase (FC = 2.75 - 4.35)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of guanosine levels compared with control group.
Guanosine monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Guanosine monophosphate concentration: increase (FC = 1.87)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of guanosine monophosphate levels compared with control group.
Inosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Inosine concentration: increase (FC = 1.18)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of inosine levels compared with control group.
N6-Methyladenosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N6-Methyladenosine concentration: increase (FC = 17.37 / 17.67)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of N6-methyladenosine levels compared with control group.
NAD		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	NAD concentration: decrease (FC = 0.18 / 0.24)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of NAD levels compared with control group.
NADH		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	NADH concentration: decrease (FC = 0.17 / 0.18)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of NADH levels compared with control group.
Nicotinic acid adenine dinucleotide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Nicotinic acid adenine dinucleotide concentration: decrease (FC = 0.02 / 0.02)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of nicotinic acid adenine dinucleotide levels compared with control group.
S-Adenosylhomocysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	S-Adenosylhomocysteine concentration: decrease (FC = 0.23 / 0.30)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of s-adenosylhomocysteine levels compared with control group.
Uridine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Uridine concentration: decrease (FC = 0.68 / 0.82)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of uridine levels compared with control group.
Xanthosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Xanthosine concentration: increase (FC = 4.12)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of xanthosine levels compared with control group.
Benzenoids
Adenylsuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Adenylsuccinic acid concentration: decrease (FC = 0.51 / 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of adenylsuccinic acid levels compared with control group.
Lipids and lipid-like molecules
10Z-Heptadecenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	10Z-Heptadecenoic acid concentration: increase (FC = 2.22)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 10Z-heptadecenoic acid levels compared with control group.
10Z-Nonadecenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	10Z-Nonadecenoic acid concentration: increase (FC = 4.78 / 7.34)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 10Z-nonadecenoic acid levels compared with control group.
11-Eicosenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	11-Eicosenoic acid concentration: increase (FC = 5.71 / 6.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 11-eicosenoic acid levels compared with control group.
15-HETE		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	15-HETE concentration: decrease (FC = 0.38 / 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 15-HETE levels compared with control group.
15-Methylpalmitate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	15-Methylpalmitate concentration: increase (FC = 2.07)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 15-methylpalmitate levels compared with control group.
17-Methyloctadecanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	17-Methyloctadecanoic acid concentration: increase (FC = 2.11 / 3.20)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 17-methyloctadecanoic acid levels compared with control group.
2-Docosahexaenoylglycerophosphoethanolamine*		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Docosahexaenoylglycerophosphoethanolamine* concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 2-docosahexaenoylglycerophosphoethanolamine* levels compared with control group.
2-Docosapentaenoylglycerophosphoethanolamine*		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Docosapentaenoylglycerophosphoethanolamine* concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 2-docosapentaenoylglycerophosphoethanolamine* levels compared with control group.
2-Eicosatrienoylglycerophosphocholine*		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Eicosatrienoylglycerophosphocholine* concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 2-eicosatrienoylglycerophosphocholine* levels compared with control group.
2-Hydroxyhexadecanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Hydroxyhexadecanoic acid concentration: decrease (FC = 0.25)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 2-hydroxyhexadecanoic acid levels compared with control group.
2-Hydroxystearic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Hydroxystearic acid concentration: decrease (FC = 0.16)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 2-hydroxystearic acid levels compared with control group.
2-Methylbutyroylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Methylbutyroylcarnitine concentration: decrease (FC = 0.34 / 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 2-methylbutyroylcarnitine levels compared with control group.
3-Hydroxyisovaleric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Hydroxyisovaleric acid concentration: increase (FC = 1.78 / 2.27)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 3-hydroxyisovaleric acid levels compared with control group.
3-Methylglutarylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Methylglutarylcarnitine concentration: decrease (FC = 0.49 / 0.58)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 3-methylglutarylcarnitine levels compared with control group.
4-Trimethylammoniobutanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	4-Trimethylammoniobutanoic acid concentration: decrease (FC = 0.60 / 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 4-trimethylammoniobutanoic acid levels compared with control group.
5,8,11-Eicosatrienoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	5,8,11-Eicosatrienoic acid concentration: decrease (FC = 0.66)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 5,8,11-eicosatrienoic acid levels compared with control group.
6-Keto-prostaglandin F1a		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	6-Keto-prostaglandin F1a concentration: decrease (FC = 0.21 / 0.21)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 6-keto-prostaglandin F1a levels compared with control group.
7-Alpha-Hydroxycholesterol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	7-Alpha-Hydroxycholesterol concentration: decrease (FC = 0.08 / 0.14)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 7-alpha-hydroxycholesterol levels compared with control group.
Adrenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Adrenic acid concentration: increase (FC = 3.02)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of adrenic acid levels compared with control group.
Arachidonic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Arachidonic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of arachidonic acid levels compared with control group.
Butyrylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Butyrylcarnitine concentration: increase (FC = 1.42)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of butyrylcarnitine levels compared with control group.
Cholest-5-en-3beta-yl octadecanoate		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cholest-5-en-3beta-yl octadecanoate concentration: decrease (FC = 0.32 / 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of cholest-5-en-3beta-yl octadecanoate levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cholest-5-en-3beta-yl octadecanoate concentration: increase (FC = 1.72)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cholest-5-en-3beta-yl octadecanoate levels compared with control group.
Cholesteryl ester(16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cholesteryl ester(16:0) concentration: increase (FC = 1.45)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cholesteryl ester(16:0) levels compared with control group.
cis-Vaccenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	cis-Vaccenic acid concentration: increase (FC = 2.08 / 2.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cis-vaccenic acid levels compared with control group.
Dihomo-alpha-linolenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Dihomo-alpha-linolenic acid concentration: increase (FC = 3.68)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of dihomo-alpha-linolenic acid levels compared with control group.
Docosadienoate (22:2n6)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Docosadienoate (22:2n6) concentration: increase (FC = 5.01 / 7.30)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of docosadienoate (22:2n6) levels compared with control group.
Docosapentaenoic acid (22n-3)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Docosapentaenoic acid (22n-3) concentration: increase (FC = 2.84 / 5.44)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of docosapentaenoic acid (22n-3) levels compared with control group.
Docosatrienoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Docosatrienoic acid concentration: increase (FC = 2.20)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of docosatrienoic acid levels compared with control group.
Eicosadienoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Eicosadienoic acid concentration: increase (FC = 2.17 / 5.56)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of eicosadienoic acid levels compared with control group.
Eicosapentaenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Eicosapentaenoic acid concentration: increase (FC = 2.25 / 3.62)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of eicosapentaenoic acid levels compared with control group.
Hexanoylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Hexanoylcarnitine concentration: increase (FC = 2.26)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of hexanoylcarnitine levels compared with control group.
Hydroxyisovaleroyl carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Hydroxyisovaleroyl carnitine concentration: decrease (FC = 0.45 / 0.66)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of hydroxyisovaleroyl carnitine levels compared with control group.
Isobutyryl-L-carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isobutyryl-L-carnitine concentration: decrease (FC = 0.78 / 0.89)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isobutyryl-L-carnitine levels compared with control group.
Isovalerylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isovalerylcarnitine concentration: decrease (FC = 0.32 / 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isovalerylcarnitine levels compared with control group.
L-Acetylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	L-Acetylcarnitine concentration: increase (FC = 2.74 / 3.22)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of L-acetylcarnitine levels compared with control group.
Lathosterol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Lathosterol concentration: decrease (FC = 0.36 / 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of Lathosterol levels compared with control group.
LysoPC(0:0/16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(0:0/16:0) concentration: decrease (FC = 0.51)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(0:0/16:0) levels compared with control group.
LysoPC(0:0/18:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(0:0/18:0) concentration: decrease (FC = 0.26 / 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(0:0/18:0) levels compared with control group.
LysoPC(14:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(14:0/0:0) concentration: decrease (FC = 0.45)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(14:0/0:0) levels compared with control group.
LysoPC(15:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(15:0/0:0) concentration: decrease (FC = 0.36)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(15:0/0:0) levels compared with control group.
LysoPC(16:1(9Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(16:1(9Z)/0:0) concentration: decrease (FC = 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(16:1(9Z)/0:0) levels compared with control group.
LysoPC(18:2(9Z,12Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(18:2(9Z,12Z)/0:0) concentration: increase (FC = 2.61 / 3.93)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of lysoPC(18:2(9Z,12Z)/0:0) levels compared with control group.
LysoPC(20:4(5Z,8Z,11Z,14Z))		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(20:4(5Z,8Z,11Z,14Z)) concentration: decrease (FC = 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(20:4(5Z,8Z,11Z,14Z)) levels compared with control group.
LysoPC(22:5(4Z,7Z,10Z,13Z,16Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPC(22:5(4Z,7Z,10Z,13Z,16Z)/0:0) concentration: decrease (FC = 0.65)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPC(22:5(4Z,7Z,10Z,13Z,16Z)/0:0) levels compared with control group.
LysoPE(0:0/16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPE(0:0/16:0) concentration: decrease (FC = 0.30)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPE(0:0/16:0) levels compared with control group.
LysoPE(16:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPE(16:0/0:0) concentration: decrease (FC = 0.44 / 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPE(16:0/0:0) levels compared with control group.
LysoPE(18:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPE(18:0/0:0) concentration: decrease (FC = 0.68)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPE(18:0/0:0) levels compared with control group.
LysoPI(16:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPI(16:0/0:0) concentration: decrease (FC = 0.11 / 0.26)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPI(16:0/0:0) levels compared with control group.
LysoPI(18:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPI(18:0/0:0) concentration: decrease (FC = 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPI(18:0/0:0) levels compared with control group.
LysoPI(18:1(9Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPI(18:1(9Z)/0:0) concentration: decrease (FC = 0.30 / 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPI(18:1(9Z)/0:0) levels compared with control group.
LysoPI(20:4(5Z,8Z,11Z,14Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	LysoPI(20:4(5Z,8Z,11Z,14Z)/0:0) concentration: decrease (FC = 0.32)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of lysoPI(20:4(5Z,8Z,11Z,14Z)/0:0) levels compared with control group.
MG(0:0/18:1(9Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	MG(0:0/18:1(9Z)/0:0) concentration: increase (FC = 2.38)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of MG(0:0/18:1(9Z)/0:0) levels compared with control group.
MG(18:2(9Z,12Z)/0:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	MG(18:2(9Z,12Z)/0:0/0:0) concentration: increase (FC = 1.70 / 3.29)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of MG(18:2(9Z,12Z)/0:0/0:0) levels compared with control group.
Nonadecanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Nonadecanoic acid concentration: increase (FC = 1.38 / 2.27)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of nonadecanoic acid levels compared with control group.
Oleic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Oleic acid concentration: increase (FC = 2.22 / 2.70)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of oleic acid levels compared with control group.
Oleoylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Oleoylcarnitine concentration: increase (FC = 6.64 - 16.84)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of oleoylcarnitine levels compared with control group.
Palmitoleic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Palmitoleic acid concentration: increase (FC = 1.25)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of palmitoleic acid levels compared with control group.
Pelargonic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Pelargonic acid concentration: decrease (FC = 0.87)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of pelargonic acid levels compared with control group.
Pentadecanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Pentadecanoic acid concentration: decrease (FC = 0.80)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of pentadecanoic acid levels compared with control group.
Prostaglandin E2		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Prostaglandin E2 concentration: decrease (FC = 0.19 / 0.19)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of prostaglandin E2 levels compared with control group.
Prostaglandin I2		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Prostaglandin I2 concentration: decrease (FC = 0.23 / 0.23)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of prostaglandin I2 levels compared with control group.
SM(d18:1/16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	SM(d18:1/16:0) concentration: increase (FC = 1.52 - 1.62)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of SM(d18:1/16:0) levels compared with control group.
SM(d18:1/18:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	SM(d18:1/18:0) concentration: increase (FC = 5.30 - 6.24)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of SM(d18:1/18:0) levels compared with control group.
Tiglylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Tiglylcarnitine concentration: decrease (FC = 0.33 / 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of tiglylcarnitine levels compared with control group.
Valerylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Valerylcarnitine concentration: increase (FC = 1.79 / 1.89)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of valerylcarnitine levels compared with control group.
Organic acids and derivatives
2-Hydroxyglutarate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	2-Hydroxyglutarate concentration: increase (FC = 1.72 / 2.05)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 2-hydroxyglutarate levels compared with control group.
3-Dehydrocarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Dehydrocarnitine concentration: decrease (FC = 0.60 / 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 3-dehydrocarnitine levels compared with control group.
3-Hydroxycapric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Hydroxycapric acid concentration: increase (FC = 1.93)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 3-hydroxycapric acid levels compared with control group.
4-Acetamidobutanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	4-Acetamidobutanoic acid concentration: decrease (FC = 0.30 / 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 4-acetamidobutanoic acid levels compared with control group.
4-Hydroxyproline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	4-Hydroxyproline concentration: decrease (FC = 0.48 / 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 4-hydroxyproline levels compared with control group.
Alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Alanine concentration: decrease (FC = 0.47 / 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of alanine levels compared with control group.
Alanylphenylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Alanylphenylalanine concentration: decrease (FC = 0.25 / 0.33)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of alanylphenylalanine levels compared with control group.
Arginine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Arginine concentration: decrease (FC = 0.31 / 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of arginine levels compared with control group.
Argininosuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Argininosuccinic acid concentration: decrease (FC = 0.08 / 0.08)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of argininosuccinic acid levels compared with control group.
Asparagine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Asparagine concentration: decrease (FC = 0.56 / 0.57)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of asparagine levels compared with control group.
Aspartic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Aspartic acid concentration: decrease (FC = 0.30 / 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of aspartic acid levels compared with control group.
Asymmetric dimethylarginine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Asymmetric dimethylarginine concentration: increase (FC = 1.59)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of asymmetric dimethylarginine levels compared with control group.
Beta-Alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Beta-Alanine concentration: increase (FC = 2.00)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of beta-alanine levels compared with control group.
Citrulline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Citrulline concentration: decrease (FC = 0.34 / 0.51)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of citrulline levels compared with control group.
Creatine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Creatine concentration: increase (FC = 1.73 - 1.88)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of creatine levels compared with control group.
Cysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cysteine concentration: increase (FC = 8.91 - 10.32)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cysteine levels compared with control group.
Cysteineglutathione disulfide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cysteineglutathione disulfide concentration: increase (FC = 5.85 - 6.04)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cysteineglutathione disulfide levels compared with control group.
Cysteinylglycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Cysteinylglycine concentration: increase (FC = 2.09)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of cysteinylglycine levels compared with control group.
D-Ornithine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	D-Ornithine concentration: decrease (FC = 0.36 / 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of D-Ornithine levels compared with control group.
Gamma-Glutamylglutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Gamma-Glutamylglutamic acid concentration: increase (FC = 6.23 - 7.31)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of gamma-glutamylglutamic acid levels compared with control group.
Gamma-Glutamylisoleucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Gamma-Glutamylisoleucine concentration: decrease (FC = 0.55 / 0.66)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of gamma-glutamylisoleucine levels compared with control group.
Gamma-Glutamylmethionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Gamma-Glutamylmethionine concentration: increase (FC = 2.77 - 3.73)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of gamma-glutamylmethionine levels compared with control group.
Gamma-Glutamylphenylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Gamma-Glutamylphenylalanine concentration: increase (FC = 1.77 - 1.88)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of gamma-Glutamylphenylalanine levels compared with control group.
Gamma-Glutamylvaline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Gamma-Glutamylvaline concentration: decrease (FC = 0.52 / 0.64)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of gamma-glutamylvaline levels compared with control group.
Glutamylvaline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glutamylvaline concentration: decrease (FC = 0.31 / 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of glutamylvaline levels compared with control group.
Glutathione		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glutathione concentration: decrease (FC = 0.44 / 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of glutathione levels compared with control group.
Glycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glycine concentration: increase (FC = 1.11)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of glycine levels compared with control group.
Glycyl-Isoleucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glycyl-Isoleucine concentration: decrease (FC = 0.32 / 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of glycyl-Isoleucine levels compared with control group.
Glycylleucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glycylleucine concentration: decrease (FC = 0.06 / 0.11)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of glycylleucine levels compared with control group.
Histidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Histidine concentration: decrease (FC = 0.53 / 0.56)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of histidine levels compared with control group.
Hypotaurine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Hypotaurine concentration: increase (FC = 1.99 - 2.38)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of hypotaurine levels compared with control group.
Isoleucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isoleucine concentration: decrease (FC = 0.49 / 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isoleucine levels compared with control group.
Isoleucyl-Alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isoleucyl-Alanine concentration: decrease (FC = 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isoleucyl-Alanine levels compared with control group.
Isoleucyl-Glycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isoleucyl-Glycine concentration: decrease (FC = 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isoleucyl-Glycine levels compared with control group.
Isoleucyl-Serine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Isoleucyl-Serine concentration: decrease (FC = 0.10 / 0.16)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of isoleucyl-Serine levels compared with control group.
L-alpha-Aminobutyric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	L-alpha-Aminobutyric acid concentration: decrease (FC = 0.54 / 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of L-alpha-Aminobutyric acid levels compared with control group.
Lactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Lactic acid concentration: increase (FC = 1.5)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of lactic acid levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Overexpression of SULF1
Induced Change	Lactic acid concentration: decrease (FC = 0.79)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that overexpression of SULF1 leads to the decrease of lactic acid levels compared with control group.
Leucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Leucine concentration: decrease (FC = 0.56 / 0.58)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of leucine levels compared with control group.
Leucylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Leucylalanine concentration: decrease (FC = 0.47 / 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of leucylalanine levels compared with control group.
Methionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Methionine concentration: decrease (FC = 0.58 / 0.66)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of methionine levels compared with control group.
Methylphosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Methylphosphate concentration: decrease (FC = 0.64)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of methylphosphate levels compared with control group.
N-Acetyl-L-alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Acetyl-L-alanine concentration: decrease (FC = 0.70 / 0.73)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-acetyl-L-alanine levels compared with control group.
N-Acetyl-L-aspartic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Acetyl-L-aspartic acid concentration: decrease (FC = 0.32 / 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-acetyl-L-aspartic acid levels compared with control group.
N-Acetylputrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Acetylputrescine concentration: decrease (FC = 0.08 / 0.13)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-acetylputrescine levels compared with control group.
N-Acetylserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Acetylserine concentration: decrease (FC = 0.33 / 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-acetylserine levels compared with control group.
N-Acetylthreonine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Acetylthreonine concentration: decrease (FC = 0.65 / 0.71)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-acetylthreonine levels compared with control group.
N-Formyl-L-methionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N-Formyl-L-methionine concentration: decrease (FC = 0.49 / 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N-formyl-L-methionine levels compared with control group.
N2-Acetylornithine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N2-Acetylornithine concentration: decrease (FC = 0.51)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N2-acetylornithine levels compared with control group.
N6-Acetyl-L-lysine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	N6-Acetyl-L-lysine concentration: decrease (FC = 0.53)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of N6-acetyl-L-lysine levels compared with control group.
Norvaline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Norvaline concentration: decrease (FC = 0.32)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of norvaline levels compared with control group.
Ophthalmic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Ophthalmic acid concentration: decrease (FC = 0.27 / 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of ophthalmic acid levels compared with control group.
Oxidized glutathione		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Oxidized glutathione concentration: decrease (FC = 0.37 / 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of oxidized glutathione levels compared with control group.
p-Cresol sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	p-Cresol sulfate concentration: decrease (FC = 0.59)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of p-cresol sulfate levels compared with control group.
Phenol sulphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Phenol sulphate concentration: decrease (FC = 0.32 / 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of phenol sulphate levels compared with control group.
Phenylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Phenylalanine concentration: decrease (FC = 0.52 / 0.53)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of phenylalanine levels compared with control group.
Phenylalanylserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Phenylalanylserine concentration: decrease (FC = 0.07)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of phenylalanylserine levels compared with control group.
Pipecolic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Pipecolic acid concentration: decrease (FC = 0.43 / 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of pipecolic acid levels compared with control group.
Proline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Proline concentration: decrease (FC = 0.39 / 0.40)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of proline levels compared with control group.
Prolyl-Alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Prolyl-Alanine concentration: decrease (FC = 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of prolyl-alanine levels compared with control group.
Prolylhydroxyproline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Prolylhydroxyproline concentration: increase (FC = 1.92 - 2.05)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of prolylhydroxyproline levels compared with control group.
Serine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Serine concentration: decrease (FC = 0.47 / 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of serine levels compared with control group.
Serylphenylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Serylphenylalanine concentration: decrease (FC = 0.07 / 0.15)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of serylphenylalanine levels compared with control group.
Taurine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Taurine concentration: increase (FC = 5.38 - 9.91)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of taurine levels compared with control group.
Threonine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Threonine concentration: decrease (FC = 0.51 / 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of threonine levels compared with control group.
Tyrosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Tyrosine concentration: decrease (FC = 0.47 / 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of tyrosine levels compared with control group.
Valine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Valine concentration: decrease (FC = 0.47 / 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of valine levels compared with control group.
Valylglycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Valylglycine concentration: decrease (FC = 0.16 / 0.19)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of valylglycine levels compared with control group.
Valylserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Valylserine concentration: decrease (FC = 0.31 / 0.31)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of valylserine levels compared with control group.
Valylvaline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Valylvaline concentration: decrease (FC = 0.32 / 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of valylvaline levels compared with control group.
Organic nitrogen compounds
Agmatine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Agmatine concentration: decrease (FC = 0.06 / 0.06)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of agmatine levels compared with control group.
Carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Carnitine concentration: decrease (FC = 0.58 / 0.66)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of carnitine levels compared with control group.
Choline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Choline concentration: decrease (FC = 0.46 / 0.51)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of choline levels compared with control group.
Ethanolamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Ethanolamine concentration: decrease (FC = 0.59 / 0.69)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of ethanolamine levels compared with control group.
Phosphorylcholine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Phosphorylcholine concentration: decrease (FC = 0.25 / 0.36)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of phosphorylcholine levels compared with control group.
Phytosphingosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Phytosphingosine concentration: increase (FC = 4.09 / 5.76)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of phytosphingosine levels compared with control group.
Putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Putrescine concentration: decrease (FC = 0.10 / 0.11)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of putrescine levels compared with control group.
Spermidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Spermidine concentration: increase (FC = 1.33 / 1.38)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of spermidine levels compared with control group.
Spermine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Spermine concentration: decrease (FC = 0.70)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of spermine levels compared with control group.
Sphingosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Sphingosine concentration: increase (FC = 5.08)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of sphingosine levels compared with control group.
Organic oxygen compounds
3-Phosphoglyceric acid		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Phosphoglyceric acid concentration: decrease (FC = 0.53 / 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of 3-phosphoglyceric acid levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	3-Phosphoglyceric acid concentration: increase (FC = 6.02)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 3-phosphoglyceric acid levels compared with control group.
Dihydroartemisinin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Dihydroartemisinin concentration: increase (FC = 1.45 / 1.82)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of dihydroartemisinin levels compared with control group.
Fructose 1,6-bisphosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Fructose 1,6-bisphosphate concentration: increase (FC = 2.89)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of fructose 1,6-bisphosphate levels compared with control group.
Glucose		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Overexpression of SULF1
Induced Change	Glucose concentration: decrease (FC = 0.65)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that overexpression of SULF1 leads to the decrease of glucose levels compared with control group.
Glucose 6-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[2]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Glucose 6-phosphate concentration: increase (FC = 10.68)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of glucose 6-phosphate levels compared with control group.
L-Kynurenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	L-Kynurenine concentration: decrease (FC = 0.45 / 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of L-kynurenine levels compared with control group.
myo-Inositol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	myo-Inositol concentration: increase (FC = 3.10 - 3.79)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of myo-inositol levels compared with control group.
myo-Inositol 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	myo-Inositol 1-phosphate concentration: decrease (FC = 0.70 / 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of myo-inositol 1-phosphate levels compared with control group.
Pantothenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Pantothenic acid concentration: decrease (FC = 0.37 / 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of pantothenic acid levels compared with control group.
Scyllo-Inositol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Scyllo-Inositol concentration: increase (FC = 3.11 - 4.64)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of scyllo-Inositol levels compared with control group.
Organoheterocyclic compounds
5-Methyltetrahydrofolic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	5-Methyltetrahydrofolic acid concentration: increase (FC = 2.19 / 2.89)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of 5-methyltetrahydrofolic acid levels compared with control group.
Adenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Adenine concentration: increase (FC = 1.52)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of adenine levels compared with control group.
Biotin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Biotin concentration: decrease (FC = 0.30 / 0.36)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of biotin levels compared with control group.
Guanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Guanine concentration: increase (FC = 8.39 - 10.21)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of guanine levels compared with control group.
Nicotinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Nicotinic acid concentration: increase (FC = 1.84 - 1.84)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of nicotinic acid levels compared with control group.
Picolinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Picolinic acid concentration: decrease (FC = 0.44 / 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of picolinic acid levels compared with control group.
Serotonin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Serotonin concentration: increase (FC = 2.87)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of serotonin levels compared with control group.
Thymine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Thymine concentration: decrease (FC = 0.41)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of thymine levels compared with control group.
Tryptophan		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Tryptophan concentration: decrease (FC = 0.59 / 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of tryptophan levels compared with control group.
Tryptophan 2-C-mannoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Tryptophan 2-C-mannoside concentration: increase (FC = 1.71 - 3.82)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the increase of tryptophan 2-c-mannoside levels compared with control group.
Uracil		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Uracil concentration: decrease (FC = 0.58)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of uracil levels compared with control group.
Phenylpropanoids and polyketides
Hydroxyphenyllactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (shRNA) of SULF1
Induced Change	Hydroxyphenyllactic acid concentration: decrease (FC = 0.19 / 0.26)
Summary	Introduced Variation Induced Change
Disease Status	Ovarian cancer [ICD-11: 2C73]
Details	It is reported that knockdown of SULF1 leads to the decrease of hydroxyphenyllactic acid levels compared with control group.

References
1	Erratum to: Loss of HSulf-1 promotes altered lipid metabolism in ovarian cancer. Cancer Metab. 2014 Nov 4;2:24.
2	HSulf-1 deficiency dictates a metabolic reprograming of glycolysis and TCA cycle in ovarian cancer. Oncotarget. 2015 Oct 20;6(32):33705-19.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.