Details of Protein

General Information of Protein (ID: PRT00065)
Name	Apolipoprotein A-II (APOA2)
Synonyms	Click to Show/Hide Synonyms of This Protein Apo-AII; ApoA-II; Apolipoprotein A2; APOA2
Gene Name	APOA2	Gene ID	336
UniProt ID	P02652
Family	Apolipoprotein (Apo)
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Function	May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulated by This Protein
Nucleosides, nucleotides, and analogues
Adenosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Adenosine concentration: increase (FC = 1.59)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of adenosine levels compared with control group.
Uridine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Uridine concentration: increase (FC = 1.13)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of uridine levels compared with control group.
Benzenoids
4-Hydroxyphenyl acetate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	4-Hydroxyphenyl acetate concentration: decrease (FC = 0.42)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 4-hydroxyphenyl acetate levels compared with control group.
Atenolol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Atenolol concentration: decrease (FC = 0.03)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of atenolol levels compared with control group.
Benzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Benzoic acid concentration: decrease (FC = 0.67)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of benzoic acid levels compared with control group.
Hippuric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hippuric acid concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of hippuric acid levels compared with control group.
Ortho-Hydroxyphenylacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Ortho-Hydroxyphenylacetic acid concentration: decrease (FC = 0.78)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of ortho-Hydroxyphenylacetic acid levels compared with control group.
Phenylpyruvic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Phenylpyruvic acid concentration: decrease (FC = 0.74)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of phenylpyruvic acid levels compared with control group.
Salicylate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Salicylate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of salicylate levels compared with control group.
Homogeneous non-metal compounds
Sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Sulfate concentration: decrease (FC = 0.83)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of sulfate levels compared with control group.
Lipid-related molecules
1-Linolenoylglycerol (18:3)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1-Linolenoylglycerol (18:3) concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1-linolenoylglycerol (18:3) levels compared with control group.
Diacylglycerol (14:0/18:1, 16:0/16:1)		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Diacylglycerol (14:0/18:1, 16:0/16:1) concentration: decrease (FC = 0.59)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of diacylglycerol (14:0/18:1, 16:0/16:1) levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Diacylglycerol (14:0/18:1, 16:0/16:1) concentration: decrease (FC = 0.56)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of diacylglycerol (14:0/18:1, 16:0/16:1) levels compared with control group.
Lipids and lipid-like molecules
1-Palmitoleoylglycerol (16:1)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1-Palmitoleoylglycerol (16:1) concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1-palmitoleoylglycerol (16:1) levels compared with control group.
1-Palmitoylglycerol (16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1-Palmitoylglycerol (16:0) concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1-palmitoylglycerol (16:0) levels compared with control group.
1-Tetradecanoyl-sn-glycero-3-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1-Tetradecanoyl-sn-glycero-3-phosphate concentration: decrease (FC = 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1-tetradecanoyl-sn-glycero-3-phosphate levels compared with control group.
2-Ethylhydracrylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Ethylhydracrylic acid concentration: decrease (FC = 0.78)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-ethylhydracrylic acid levels compared with control group.
2-Hydroxy-3-methylbutyric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Hydroxy-3-methylbutyric acid concentration: decrease (FC = 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-hydroxy-3-methylbutyric acid levels compared with control group.
2-Hydroxy-3-methylpentanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Hydroxy-3-methylpentanoic acid concentration: decrease (FC = 0.55)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-hydroxy-3-methylpentanoic acid levels compared with control group.
2-Methylbutyroylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Methylbutyroylcarnitine concentration: decrease (FC = 0.67)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-methylbutyroylcarnitine levels compared with control group.
2-Methylglutaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Methylglutaric acid concentration: decrease (FC = 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-methylglutaric acid levels compared with control group.
3-Hydroxyisovaleric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	3-Hydroxyisovaleric acid concentration: decrease (FC = 0.72)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 3-hydroxyisovaleric acid levels compared with control group.
3-Hydroxymethylglutaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	3-Hydroxymethylglutaric acid concentration: decrease (FC = 0.75)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 3-hydroxymethylglutaric acid levels compared with control group.
4-Androstenediol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	4-Androstenediol concentration: increase (FC = 2.13)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of 4-androstenediol levels compared with control group.
7-Alpha-Hydroxy-3-oxo-4-cholestenoate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	7-Alpha-Hydroxy-3-oxo-4-cholestenoate concentration: increase (FC = 1.40)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of 7-alpha-hydroxy-3-oxo-4-cholestenoate levels compared with control group.
Dehydroepiandrosterone sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Dehydroepiandrosterone sulfate concentration: increase (FC = 1.57)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of dehydroepiandrosterone sulfate levels compared with control group.
Deoxycholic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Deoxycholic acid concentration: decrease (FC = 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of deoxycholic acid levels compared with control group.
Docosadienoate (22:2n6)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Docosadienoate (22:2n6) concentration: increase (FC = 1.39)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of docosadienoate (22:2n6) levels compared with control group.
Eicosanedioic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Eicosanedioic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of eicosanedioic acid levels compared with control group.
Glycine deoxycholate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Glycine deoxycholate concentration: decrease (FC = 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of glycine deoxycholate levels compared with control group.
Glycodeoxycholate sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Glycodeoxycholate sulfate concentration: decrease (FC = 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of glycodeoxycholate sulfate levels compared with control group.
Hydroxyisocaproic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hydroxyisocaproic acid concentration: decrease (FC = 0.71)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of hydroxyisocaproic acid levels compared with control group.
Isobutyryl-L-carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Isobutyryl-L-carnitine concentration: decrease (FC = 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of isobutyryl-L-carnitine levels compared with control group.
Linoleoylcarnitine (C18:2)*		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Linoleoylcarnitine (C18:2)*linoleoylcarnitine (C18: 2) concentration: increase (FC = 1.25)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of linoleoylcarnitine (C18:2)* levels compared with control group.
MG(0:0/16:1(9Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	MG(0:0/16:1(9Z)/0:0) concentration: decrease (FC = 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of MG(0:0/16:1(9Z)/0:0) levels compared with control group.
Oleoylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Oleoylcarnitine concentration: increase (FC = 1.28)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of oleoylcarnitine levels compared with control group.
PC(18:1(9Z)/18:2(9Z,12Z))		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	PC(18:1(9Z)/18:2(9Z,12Z)) concentration: increase (FC = 1.25)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of PC(18:1(9Z)/18:2(9Z,12Z)) levels compared with control group.
PE(18:0/20:4(5Z,8Z,11Z,14Z))		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	PE(18:0/20:4(5Z,8Z,11Z,14Z)) concentration: increase (FC = 1.64)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of PE(18:0/20:4(5Z,8Z,11Z,14Z)) levels compared with control group.
Propionylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Propionylcarnitine concentration: decrease (FC = 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of propionylcarnitine levels compared with control group.
Solanidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Solanidine concentration: increase (FC = 3.39)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of solanidine levels compared with control group.
Sphinganine 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Sphinganine 1-phosphate concentration: increase (FC = 1.65)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of sphinganine 1-phosphate levels compared with control group.
Succinylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Succinylcarnitine concentration: decrease (FC = 0.85)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of succinylcarnitine levels compared with control group.
Tauro-beta-muricholic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Tauro-beta-muricholic acid concentration: decrease (FC = 0.06)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of tauro-beta-muricholic acid levels compared with control group.
Taurodeoxycholic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Taurodeoxycholic acid concentration: decrease (FC = 0.20)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of taurodeoxycholic acid levels compared with control group.
TG(16:0/14:0/16:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	TG(16:0/14:0/16:0) concentration: decrease (FC = 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of TG(16:0/14:0/16:0) levels compared with control group.
Tiglylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Tiglylcarnitine concentration: decrease (FC = 0.75)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of tiglylcarnitine levels compared with control group.
Organic acids
DSGEGDFXAEGGGVR		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	DSGEGDFXAEGGGVR concentration: decrease (FC = 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of DSGEGDFXAEGGGVR levels compared with control group.
Organic acids and derivatives
1-Pyrroline-5-carboxylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1-Pyrroline-5-carboxylic acid concentration: decrease (FC = 0.60)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1-pyrroline-5-carboxylic acid levels compared with control group.
4-Allylphenol sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	4-Allylphenol sulfate concentration: decrease (FC = 0.32)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 4-allylphenol sulfate levels compared with control group.
4-Hydroxy-L-glutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	4-Hydroxy-L-glutamic acid concentration: decrease (FC = 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 4-hydroxy-L-glutamic acid levels compared with control group.
4-Hydroxyphenylacetylglutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	4-Hydroxyphenylacetylglutamic acid concentration: decrease (FC = 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 4-hydroxyphenylacetylglutamic acid levels compared with control group.
6-Hydroxyindole sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	6-Hydroxyindole sulfate concentration: decrease (FC = 0.61)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 6-hydroxyindole sulfate levels compared with control group.
6-Oxopiperidine-2-carboxylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	6-Oxopiperidine-2-carboxylic acid concentration: decrease (FC = 0.73)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 6-oxopiperidine-2-carboxylic acid levels compared with control group.
Betaine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Betaine concentration: increase (FC = 1.18)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of betaine levels compared with control group.
Carnosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Carnosine concentration: decrease (FC = 0.04)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of carnosine levels compared with control group.
Cinnamoylglycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Cinnamoylglycine concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of cinnamoylglycine levels compared with control group.
Cys-gly		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Cys-gly concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of cys-gly levels compared with control group.
Cysteine-S-sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Cysteine-S-sulfate concentration: increase (FC = 1.52)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of cysteine-S-sulfate levels compared with control group.
DL-2-Aminooctanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	DL-2-Aminooctanoic acid concentration: increase (FC = 1.74)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of DL-2-Aminooctanoic acid levels compared with control group.
Edetic Acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Edetic Acid concentration: increase (FC = 1.17)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of edetic Acid levels compared with control group.
Gamma-Glutamylglutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Gamma-Glutamylglutamic acid concentration: decrease (FC = 0.45)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of gamma-glutamylglutamic acid levels compared with control group.
Glutamic acid gamma-methyl ester		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Glutamic acid gamma-methyl ester concentration: decrease (FC = 0.21)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of glutamic acid gamma-methyl ester levels compared with control group.
Hydroquinone sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hydroquinone sulfate concentration: decrease (FC = 0.54)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of hydroquinone sulfate levels compared with control group.
Indoleacetyl glutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Indoleacetyl glutamine concentration: decrease (FC = 0.41)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of indoleacetyl glutamine levels compared with control group.
Indoxyl sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Indoxyl sulfate concentration: decrease (FC = 0.62)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of indoxyl sulfate levels compared with control group.
L-Cystathionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	L-Cystathionine concentration: decrease (FC = 0.71)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of L-cystathionine levels compared with control group.
Malonic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Malonic acid concentration: decrease (FC = 0.83)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of malonic acid levels compared with control group.
Methionine sulfoxide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Methionine sulfoxide concentration: decrease (FC = 0.74)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of methionine sulfoxide levels compared with control group.
Methyl-4-hydroxybenzoate sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Methyl-4-hydroxybenzoate sulfate concentration: decrease (FC = 0.90)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of methyl-4-hydroxybenzoate sulfate levels compared with control group.
N-(5-Aminopentyl)-N-hydroxyacetamide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-(5-Aminopentyl)-N-hydroxyacetamide concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-(5-aminopentyl)-N-hydroxyacetamide levels compared with control group.
N-Acetyl-1-methylhistidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetyl-1-methylhistidine concentration: decrease (FC = 0.46)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetyl-1-methylhistidine levels compared with control group.
N-Acetyl-L-alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetyl-L-alanine concentration: decrease (FC = 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetyl-L-alanine levels compared with control group.
N-Acetyl-L-methionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetyl-L-methionine concentration: increase (FC = 1.15)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of N-acetyl-L-methionine levels compared with control group.
N-Acetylhistidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylhistidine concentration: decrease (FC = 0.74)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylhistidine levels compared with control group.
N-Acetylputrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylputrescine concentration: decrease (FC = 0.69)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylputrescine levels compared with control group.
N-Acetylserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylserine concentration: decrease (FC = 0.85)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylserine levels compared with control group.
N-Acetylthreonine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylthreonine concentration: decrease (FC = 0.78)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylthreonine levels compared with control group.
N-Acetylvaline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylvaline concentration: decrease (FC = 0.80)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylvaline levels compared with control group.
N-alpha-Acetyl-L-citrulline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-alpha-Acetyl-L-citrulline concentration: decrease (FC = 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-alpha-acetyl-L-citrulline levels compared with control group.
N-Formyl-L-methionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Formyl-L-methionine concentration: decrease (FC = 0.86)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-formyl-L-methionine levels compared with control group.
N6,N6,N6-Trimethyl-L-lysine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N6,N6,N6-Trimethyl-L-lysine concentration: decrease (FC = 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N6,N6,N6-Trimethyl-L-lysine levels compared with control group.
N8-Acetylspermidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N8-Acetylspermidine concentration: decrease (FC = 0.80)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N8-acetylspermidine levels compared with control group.
O-Sulfotyrosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	O-Sulfotyrosine concentration: decrease (FC = 0.77)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of o-sulfotyrosine levels compared with control group.
Phenol sulphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Phenol sulphate concentration: decrease (FC = 0.52)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of phenol sulphate levels compared with control group.
Phenylacetylglutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Phenylacetylglutamine concentration: decrease (FC = 0.73)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of phenylacetylglutamine levels compared with control group.
Pyrraline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Pyrraline concentration: decrease (FC = 0.45)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of pyrraline levels compared with control group.
Urea		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Urea concentration: decrease (FC = 0.81)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of urea levels compared with control group.
Organic nitrogen compounds
Linoleoyl ethanolamide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Linoleoyl ethanolamide concentration: increase (FC = 1.55)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of linoleoyl ethanolamide levels compared with control group.
Trimethylamine N-oxide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Trimethylamine N-oxide concentration: decrease (FC = 0.71)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of trimethylamine N-oxide levels compared with control group.
Organic oxygen compounds
3-Phosphoglyceric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	3-Phosphoglyceric acid concentration: increase (FC = 1.53)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of 3-phosphoglyceric acid levels compared with control group.
Erythritol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Erythritol concentration: decrease (FC = 0.79)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of erythritol levels compared with control group.
N-Acetylkynurenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	N-Acetylkynurenine concentration: decrease (FC = 0.36)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of N-acetylkynurenine levels compared with control group.
Palmitoyl-arachidonoyl-glycerol (16:0/20:4)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	palmitoyl-arachidonoyl-glycerol (16:0/20:4) concentration: decrease (FC = 0.10)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of palmitoyl-arachidonoyl-glycerol (16:0/20:4) levels compared with control group.
Palmitoyl-oleoyl-glycerol (16:0/18:1)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Palmitoyl-oleoyl-glycerol (16:0/18:1) concentration: decrease (FC = 0.58)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of palmitoyl-oleoyl-glycerol (16:0/18:1) levels compared with control group.
Organo heterocyclic compounds
Heme		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Heme concentration: increase (FC = 1.95)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of heme levels compared with control group.
Organoheterocyclic compounds
1,3-Dihydro-(2H)-indol-2-one		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	1,3-Dihydro-(2H)-indol-2-one concentration: decrease (FC = 0.63)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 1,3-dihydro-(2H)-indol-2-one levels compared with control group.
2-Hydroxy-3-(1H-imidazol-5-yl)propanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	2-Hydroxy-3-(1H-imidazol-5-yl)propanoic acid concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 2-hydroxy-3-(1H-imidazol-5-yl)propanoic acid levels compared with control group.
7-Methylxanthine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	7-Methylxanthine concentration: decrease (FC = 0.64)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of 7-methylxanthine levels compared with control group.
Cytosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Cytosine concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of cytosine levels compared with control group.
Hypoxanthine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hypoxanthine concentration: increase (FC = 1.56)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of hypoxanthine levels compared with control group.
Indolelactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Indolelactic acid concentration: decrease (FC = 0.74)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of indolelactic acid levels compared with control group.
Kynurenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Kynurenic acid concentration: decrease (FC = 0.80)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of kynurenic acid levels compared with control group.
Pyridoxal		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Pyridoxal concentration: increase (FC = 2.35)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the increase of pyridoxal levels compared with control group.
Uric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Uric acid concentration: decrease (FC = 0.90)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of uric acid levels compared with control group.
Xanthurenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Xanthurenic acid concentration: decrease (FC = 0.69)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of xanthurenic acid levels compared with control group.
Organosulfur compounds
Dimethyl sulfone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Dimethyl sulfone concentration: decrease (FC = 0.58)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of dimethyl sulfone levels compared with control group.
Phenylpropanoids and polyketides
Hydrocinnamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hydrocinnamic acid concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of hydrocinnamic acid levels compared with control group.
Hydroxyphenyllactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Hydroxyphenyllactic acid concentration: decrease (FC = 0.73)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of hydroxyphenyllactic acid levels compared with control group.
Phenyllactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Mutation (-265T >C(rs5082)) of APOA2
Induced Change	Phenyllactic acid concentration: decrease (FC = 0.65)
Summary	Introduced Variation Induced Change
Disease Status	Obesity [ICD-11: 5B81]
Details	It is reported that mutation (-265T >C(rs5082)) of APOA2 leads to the decrease of phenyllactic acid levels compared with control group.

References
1	Epigenomics and metabolomics reveal the mechanism of the APOA2-saturated fat intake interaction affecting obesity. Am J Clin Nutr. 2018 Jul 1;108(1):188-200.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.