Details of Protein

General Information of Protein (ID: PRT00798)
Name	Leukotriene-C4 hydrolase (GGT1)
Synonyms	Click to Show/Hide Synonyms of This Protein Gamma-glutamyltransferase 1; Gamma-glutamyltranspeptidase 1; GGT 1; Leukotriene-C4 hydrolase; CD antigen CD224; GGT1; GGT
Gene Name	GGT1	Gene ID	2678
UniProt ID	P19440
Family	Hydrolases (EC 3)
EC Number	EC: 3.4.19.13 (Click to Show/Hide the Complete EC Tree) Hydrolases Peptidase Omega peptidase EC: 3.4.19.13
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRD GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALEN KRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKD IQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSR ESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD DTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTA TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTF IAVVQAIVRTAGGWAAASDSRKGGEPAGY
Structure	4GDX ; 4GG2 ; 4Z9O ; 4ZBK ; 4ZC6 ; 4ZCG ; 5V4Q
Function	Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates and other gamma-glutamyl compounds, such as leukotriene C4 (LTC4). The metabolism of glutathione by GGT1 releases free glutamate and the dipeptide cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Contributes to cysteine homeostasis, glutathione homeostasis and in the conversion of the leukotriene LTC4 to LTD4.; [Isoform 3]: Seems to be inactive.
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulated by This Protein
Nucleosides, nucleotides, and analogues
2'-Deoxyguanosine 5'-monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	2'-Deoxyguanosine 5'-monophosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 2'-deoxyguanosine 5'-monophosphate levels compared with control group.
AICAR		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	AICAR concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of AICAR levels compared with control group.
dATP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	dATP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of dATP levels compared with control group.
dCMP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	dCMP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of dCMP levels compared with control group.
Deoxyguanosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Deoxyguanosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of deoxyguanosine levels compared with control group.
Deoxyuridine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Deoxyuridine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of deoxyuridine levels compared with control group.
dGTP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	dGTP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of dGTP levels compared with control group.
Inosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Inosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of inosine levels compared with control group.
NAD		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	NAD concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of NAD levels compared with control group.
NADP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	NADP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of NADP levels compared with control group.
S-Adenosylhomocysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	S-Adenosylhomocysteine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of s-adenosylhomocysteine levels compared with control group.
S-Adenosylmethionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	S-Adenosylmethionine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of s-adenosylmethionine levels compared with control group.
Thymidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Thymidine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of thymidine levels compared with control group.
UDP glucose		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	UDP glucose concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of UDP glucose levels compared with control group.
Xanthosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Xanthosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of xanthosine levels compared with control group.
Benzenoids
2-Aminobenzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	2-Aminobenzoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 2-aminobenzoic acid levels compared with control group.
3-Hydroxyphenylpyruvic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	3-Hydroxyphenylpyruvic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 3-hydroxyphenylpyruvic acid levels compared with control group.
3-Methylphenylacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	3-Methylphenylacetic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 3-methylphenylacetic acid levels compared with control group.
Adenylsuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Adenylsuccinic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of adenylsuccinic acid levels compared with control group.
Guanosine 3',5'-bis(diphosphate)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Guanosine 3',5'-bis(diphosphate) concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of guanosine 3',5'-bis(diphosphate) levels compared with control group.
p-Aminobenzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	p-Aminobenzoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of p-aminobenzoic acid levels compared with control group.
p-Hydroxyphenylacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	p-Hydroxyphenylacetic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of p-hydroxyphenylacetic acid levels compared with control group.
Phenylpropiolic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phenylpropiolic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phenylpropiolic acid levels compared with control group.
Vanillylmandelic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Vanillylmandelic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of vanillylmandelic acid levels compared with control group.
Lipid-related molecules
Hexose-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Hexose-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of hexose-phosphate levels compared with control group.
Lipids and lipid-like molecules
2-Isopropylmalic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	2-Isopropylmalic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 2-isopropylmalic acid levels compared with control group.
Cholesterol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Cholesterol concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of cholesterol levels compared with control group.
Cholesterol sulfate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Cholesterol sulfate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of cholesterol sulfate levels compared with control group.
Citraconic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Citraconic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of citraconic acid levels compared with control group.
DL-Acetylcarnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	DL-Acetylcarnitine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of DL-acetylcarnitine levels compared with control group.
Geranyl-PP		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Geranyl-PP concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of geranyl-PP levels compared with control group.
Glycerophosphocholine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glycerophosphocholine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glycerophosphocholine levels compared with control group.
Succinyl-CoA		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Succinyl-CoA concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of succinyl-CoA levels compared with control group.
Taurodeoxycholic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Taurodeoxycholic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of taurodeoxycholic acid levels compared with control group.
Organic acids and derivatives
1-Methylhistidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	1-Methylhistidine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 1-methylhistidine levels compared with control group.
4-Hydroxyproline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	4-Hydroxyproline concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 4-hydroxyproline levels compared with control group.
Acetoacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Acetoacetic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of acetoacetic acid levels compared with control group.
Alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Alanine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of alanine levels compared with control group.
Allantoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Allantoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of allantoic acid levels compared with control group.
Alpha-Ketoisovaleric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Alpha-Ketoisovaleric acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of alpha-Ketoisovaleric acid levels compared with control group.
Aminoadipic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Aminoadipic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of aminoadipic acid levels compared with control group.
Arginine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Arginine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of arginine levels compared with control group.
Argininosuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Argininosuccinic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of argininosuccinic acid levels compared with control group.
Asparagine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Asparagine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of asparagine levels compared with control group.
Betaine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Betaine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of betaine levels compared with control group.
Carbamoyl phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Carbamoyl phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of carbamoyl phosphate levels compared with control group.
cis-Aconitic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	cis-Aconitic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of cis-aconitic acid levels compared with control group.
Citric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Citric acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of citric acid levels compared with control group.
Citrulline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Citrulline concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of citrulline levels compared with control group.
Creatine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Creatine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of creatine levels compared with control group.
Creatinine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Creatinine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of creatinine levels compared with control group.
D-Pipecolic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	D-Pipecolic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of D-Pipecolic acid levels compared with control group.
Dihydrofolic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Dihydrofolic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of dihydrofolic acid levels compared with control group.
Dimethylglycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Dimethylglycine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of dimethylglycine levels compared with control group.
DL-2-Aminooctanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	DL-2-Aminooctanoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of DL-2-Aminooctanoic acid levels compared with control group.
Folic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Folic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of folic acid levels compared with control group.
Gamma-Aminobutyric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Gamma-Aminobutyric acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of gamma-aminobutyric acid levels compared with control group.
Glutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glutamic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glutamic acid levels compared with control group.
Glutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glutamine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glutamine levels compared with control group.
Glycine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glycine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glycine levels compared with control group.
Glyoxylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glyoxylic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glyoxylic acid levels compared with control group.
Histidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Histidine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of histidine levels compared with control group.
Homocysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Homocysteine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of homocysteine levels compared with control group.
Isocitrate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Isocitrate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of isocitrate levels compared with control group.
L-Dihydroorotic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	L-Dihydroorotic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of L-dihydroorotic acid levels compared with control group.
L-Homoserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	L-Homoserine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of L-homoserine levels compared with control group.
Lactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Lactic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of lactic acid levels compared with control group.
Leucyl-Isoleucine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Leucyl-Isoleucine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of leucyl-Isoleucine levels compared with control group.
Lysine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Lysine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of lysine levels compared with control group.
Maleic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Maleic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of maleic acid levels compared with control group.
Malic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Malic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of malic acid levels compared with control group.
Melilotocarpan A		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Melilotocarpan A concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of melilotocarpan A levels compared with control group.
Methionine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Methionine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of methionine levels compared with control group.
Methionine sulfoxide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Methionine sulfoxide concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of methionine sulfoxide levels compared with control group.
Methylcysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Methylcysteine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of methylcysteine levels compared with control group.
Methylmalonic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Methylmalonic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of methylmalonic acid levels compared with control group.
N-Acetyl-L-glutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	N-Acetyl-L-glutamic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of N-acetyl-L-glutamic acid levels compared with control group.
N-Acetylglutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	N-Acetylglutamine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of N-acetylglutamine levels compared with control group.
O-Acetylserine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	O-Acetylserine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of o-acetylserine levels compared with control group.
Oxalacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Oxalacetic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of oxalacetic acid levels compared with control group.
Oxidized glutathione		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Oxidized glutathione concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of oxidized glutathione levels compared with control group.
Oxoglutaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Oxoglutaric acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of oxoglutaric acid levels compared with control group.
Phenylalanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phenylalanine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phenylalanine levels compared with control group.
Phosphocreatine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phosphocreatine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phosphocreatine levels compared with control group.
Proline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Proline concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of proline levels compared with control group.
Pyroglutamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Pyroglutamic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of pyroglutamic acid levels compared with control group.
S-Ribosylhomocysteine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	S-Ribosylhomocysteine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of s-ribosylhomocysteine levels compared with control group.
Sarcosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Sarcosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of sarcosine levels compared with control group.
Serine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Serine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of serine levels compared with control group.
Succinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Succinic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of succinic acid levels compared with control group.
Taurine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Taurine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of taurine levels compared with control group.
Threonine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Threonine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of threonine levels compared with control group.
Tyrosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Tyrosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of tyrosine levels compared with control group.
Ureidosuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Ureidosuccinic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of ureidosuccinic acid levels compared with control group.
Organic nitrogen compounds
Betaine aldehyde		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Betaine aldehyde concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of betaine aldehyde levels compared with control group.
Carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Carnitine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of carnitine levels compared with control group.
Phosphorylcholine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phosphorylcholine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phosphorylcholine levels compared with control group.
Putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Putrescine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of putrescine levels compared with control group.
Spermidine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Spermidine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of spermidine levels compared with control group.
Spermine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Spermine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of spermine levels compared with control group.
Organic oxygen compounds
5-Phosphoribosyl-4-carboxy-5-aminoimidazole		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	5-Phosphoribosyl-4-carboxy-5-aminoimidazole concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 5-phosphoribosyl-4-carboxy-5-aminoimidazole levels compared with control group.
6-Phosphonatooxy-D-gluconate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	6-Phosphonatooxy-D-gluconate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 6-phosphonatooxy-D-gluconate levels compared with control group.
6-Phosphonoglucono-D-lactone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	6-Phosphonoglucono-D-lactone concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 6-phosphonoglucono-D-lactone levels compared with control group.
Ampicillin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Ampicillin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of ampicillin levels compared with control group.
Cellobiose		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Cellobiose concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of cellobiose levels compared with control group.
D-Erythrose 4-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	D-Erythrose 4-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of D-erythrose 4-phosphate levels compared with control group.
Fructose 1,6-bisphosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Fructose 1,6-bisphosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of fructose 1,6-bisphosphate levels compared with control group.
Fructose 6-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Fructose 6-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of fructose 6-phosphate levels compared with control group.
Glucosamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glucosamine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glucosamine levels compared with control group.
Glucose 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glucose 1-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glucose 1-phosphate levels compared with control group.
Glucose 6-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glucose 6-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glucose 6-phosphate levels compared with control group.
Glycerol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Glycerol concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of glycerol levels compared with control group.
myo-Inositol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	myo-Inositol concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of myo-inositol levels compared with control group.
N-Acetyl-glucosamine 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	N-Acetyl-glucosamine 1-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of N-acetyl-glucosamine 1-phosphate levels compared with control group.
Phosphoribosyl pyrophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phosphoribosyl pyrophosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phosphoribosyl pyrophosphate levels compared with control group.
Sedoheptulose 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Sedoheptulose 1-phosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of sedoheptulose 1-phosphate levels compared with control group.
Trehalose		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Trehalose concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of trehalose levels compared with control group.
Organoheterocyclic compounds
2-Methylnicotinamide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	2-Methylnicotinamide concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of 2-methylnicotinamide levels compared with control group.
Adenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Adenine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of adenine levels compared with control group.
Allantoin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Allantoin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of allantoin levels compared with control group.
Biotin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Biotin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of biotin levels compared with control group.
Cytosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Cytosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of cytosine levels compared with control group.
Hypoxanthine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Hypoxanthine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of hypoxanthine levels compared with control group.
Imidazoleacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Imidazoleacetic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of imidazoleacetic acid levels compared with control group.
Indole-3-carboxylic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Indole-3-carboxylic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of indole-3-carboxylic acid levels compared with control group.
Kynurenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Kynurenic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of kynurenic acid levels compared with control group.
N-Methylnicotinamide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	N-Methylnicotinamide concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of N-methylnicotinamide levels compared with control group.
Orotic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Orotic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of orotic acid levels compared with control group.
Thiamine pyrophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Thiamine pyrophosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of thiamine pyrophosphate levels compared with control group.
Thymidine 3',5'-cyclic monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Thymidine 3',5'-cyclic monophosphate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of thymidine 3',5'-cyclic monophosphate levels compared with control group.
Thymine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Thymine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of thymine levels compared with control group.
Uric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Uric acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of uric acid levels compared with control group.
Xanthine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Xanthine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of xanthine levels compared with control group.
Xanthurenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Xanthurenic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of xanthurenic acid levels compared with control group.
Phenylpropanoids and polyketides
Flavone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Flavone concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of flavone levels compared with control group.
Phenyl 2,3-dihydroxybenzoate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phenyl 2,3-dihydroxybenzoate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phenyl 2,3-dihydroxybenzoate levels compared with control group.
Phenyllactic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Knockdown (siRNA) of GGT1
Induced Change	Phenyllactic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Renal cell carcinoma [ICD-11: 2C90]
Details	It is reported that knockdown of GGT1 leads to the increase of phenyllactic acid levels compared with control group.

References
1	Impairment of gamma-glutamyl transferase 1 activity in the metabolic pathogenesis of chromophobe renal cell carcinoma. Proc Natl Acad Sci U S A. 2018 Jul 3;115(27):E6274-E6282.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.