Details of Protein

General Information of Protein (ID: PRT01524)
Name	R2R3-MYB (AN2)
UniProt ID	A0A4P8VSK3
Family	Transcription factor (TF)
	*Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein*
Sequence	MMNTSVTITKSSGVRKGAWTEEEDLLLRKCIQKYGEGKWHQVPIRAGLNRCRKSCRLRWL NYLRPHIKRGDFSSEEVDLILRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLQRKLTA PHRQERKYNNALKITENTILRPRPRTFTSSSAKNVSFCSNKSITNTVDKNAHNNEILNIC EKPTGETTSVDEGVQWWTSLLENCNETEEEAEAFGSFDEENMLQSLLHEEISPPMQQGQS GNWDDFSADIDLWNLLN
Regulatory Network
Regulatory Network

Full List of Metabolite(s) Regulated by This Protein
Nucleosides, nucleotides, and analogues
2-Methylguanosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2-Methylguanosine concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 2-methylguanosine levels compared with control group.
Adenosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Adenosine concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of adenosine levels compared with control group.
Deoxyadenosine monophosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Deoxyadenosine monophosphate concentration: increase (FC = 2.66)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of deoxyadenosine monophosphate levels compared with control group.
FAD		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	FAD concentration: decrease (FC = 0.06)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of FAD levels compared with control group.
Flavin mononucleotide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Flavin mononucleotide concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of flavin mononucleotide levels compared with control group.
Inosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Inosine concentration: increase (FC = 2.51)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of inosine levels compared with control group.
Benzenoids
2,5-Dihydroxy benzoic acid O-hexside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2,5-Dihydroxy benzoic acid O-hexside concentration: increase (FC = 0.36)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 2,5-dihydroxy benzoic acid O-hexside levels compared with control group.
2,5-Dihydroxybenzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2,5-Dihydroxybenzoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 2,5-dihydroxybenzoic acid levels compared with control group.
2-Pyrocatechuic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2-Pyrocatechuic acid concentration: increase (FC = 42.23)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 2-pyrocatechuic acid levels compared with control group.
3,4-Dihydroxybenzeneacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	3,4-Dihydroxybenzeneacetic acid concentration: increase (FC = 2.04)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 3,4-dihydroxybenzeneacetic acid levels compared with control group.
4-Hydroxybenzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	4-Hydroxybenzoic acid concentration: increase (FC = 7.37)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 4-hydroxybenzoic acid levels compared with control group.
5-O-p-coumaroyl quinic acid O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5-O-p-coumaroyl quinic acid O-hexoside concentration: decrease (FC = 7.15)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 5-o-p-coumaroyl quinic acid O-hexoside levels compared with control group.
6-C-hexosyl-apigenin O-hexosyl-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	6-C-hexosyl-apigenin O-hexosyl-O-hexoside concentration: decrease (FC = 0.16)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 6-c-hexosyl-apigenin O-hexosyl-O-hexoside levels compared with control group.
8-C-hexosyl-apigenin O-hexosyl-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	8-C-hexosyl-apigenin O-hexosyl-O-hexoside concentration: decrease (FC = 2.31)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 8-c-hexosyl-apigenin O-hexosyl-O-hexoside levels compared with control group.
8-C-hexosyl-hesperetin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	8-C-hexosyl-hesperetin O-hexoside concentration: decrease (FC = 0.22)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 8-c-hexosyl-hesperetin O-hexoside levels compared with control group.
Acetosyringone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Acetosyringone concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of acetosyringone levels compared with control group.
Apigeninidin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Apigeninidin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of apigeninidin levels compared with control group.
Benzamide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Benzamide concentration: decrease (FC = 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of benzamide levels compared with control group.
Chrysin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysin O-hexoside concentration: decrease (FC = 0.20)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of chrysin O-hexoside levels compared with control group.
Chrysin O-malonylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysin O-malonylhexoside concentration: decrease (FC = 0.31)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of chrysin O-malonylhexoside levels compared with control group.
Chrysoeriol 7-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysoeriol 7-O-hexoside concentration: increase (FC = 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of chrysoeriol 7-O-hexoside levels compared with control group.
Chrysoeriol O-malonylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysoeriol O-malonylhexoside concentration: increase (FC = 0.40)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of chrysoeriol O-malonylhexoside levels compared with control group.
Coniferaldehyde		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Coniferaldehyde concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of coniferaldehyde levels compared with control group.
Echinacoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Echinacoside concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of echinacoside levels compared with control group.
Eriocitrin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Eriocitrin concentration: decrease (FC = 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of eriocitrin levels compared with control group.
Eriodictiol 6-C-hexoside 8-C-hexoside-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Eriodictiol 6-C-hexoside 8-C-hexoside-O-hexoside concentration: decrease (FC = 0.15)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of eriodictiol 6-C-hexoside 8-C-hexoside-O-hexoside levels compared with control group.
Eriodictyol C-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Eriodictyol C-hexoside concentration: increase (FC = 0.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of eriodictyol C-hexoside levels compared with control group.
Eriodictyol O-malonylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Eriodictyol O-malonylhexoside concentration: increase (FC = 6.97)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of eriodictyol O-malonylhexoside levels compared with control group.
Ethyl 3,4-dihydroxybenzoate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Ethyl 3,4-dihydroxybenzoate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of ethyl 3,4-dihydroxybenzoate levels compared with control group.
Feruloyl syringic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Feruloyl syringic acid concentration: increase (FC = 37.47)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of feruloyl syringic acid levels compared with control group.
Fustin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Fustin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of fustin levels compared with control group.
Gallic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Gallic acid concentration: increase (FC = 130592.59)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of gallic acid levels compared with control group.
Isofraxidin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isofraxidin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isofraxidin levels compared with control group.
Isohemiphloin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isohemiphloin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isohemiphloin levels compared with control group.
Isorhamnetin 5-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isorhamnetin 5-O-hexoside concentration: increase (FC = 136962.96)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isorhamnetin 5-O-hexoside levels compared with control group.
Isorhamnetin O-acetyl-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isorhamnetin O-acetyl-hexoside concentration: increase (FC = 6.27)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isorhamnetin O-acetyl-hexoside levels compared with control group.
Isorhamnetin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isorhamnetin O-hexoside concentration: increase (FC = 2.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isorhamnetin O-hexoside levels compared with control group.
Kumatakenin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Kumatakenin concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of kumatakenin levels compared with control group.
Luteolin O-hexosyl-O-hexosyl-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Luteolin O-hexosyl-O-hexosyl-O-hexoside concentration: decrease (FC = 6.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of luteolin O-hexosyl-O-hexosyl-O-hexoside levels compared with control group.
Methyl gallate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methyl gallate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of methyl gallate levels compared with control group.
methylQuercetin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	methylQuercetin O-hexoside concentration: increase (FC = 0.46)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of methylQuercetin O-hexoside levels compared with control group.
Morroniside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Morroniside concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of morroniside levels compared with control group.
Narcissin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Narcissin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of narcissin levels compared with control group.
Naringenin O-malonylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Naringenin O-malonylhexoside concentration: increase (FC = 6.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of naringenin O-malonylhexoside levels compared with control group.
p-Aminobenzoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	p-Aminobenzoic acid concentration: increase (FC = 5.70)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of p-aminobenzoic acid levels compared with control group.
Pedalitin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Pedalitin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of pedalitin levels compared with control group.
Peonidin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Peonidin O-hexoside concentration: increase (FC = 0.11)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of peonidin O-hexoside levels compared with control group.
Phenylethylamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phenylethylamine concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of phenylethylamine levels compared with control group.
Phthalic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phthalic acid concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of phthalic acid levels compared with control group.
Phthalic anhydride		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phthalic anhydride concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of phthalic anhydride levels compared with control group.
Protocatechuic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Protocatechuic acid concentration: increase (FC = 10.87)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of protocatechuic acid levels compared with control group.
Quinacyl syringic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Quinacyl syringic acid concentration: decrease (FC = 0.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of quinacyl syringic acid levels compared with control group.
Quinic acid O-glucuronic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Quinic acid O-glucuronic acid concentration: increase (FC = 0.28)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of quinic acid O-glucuronic acid levels compared with control group.
Rosinidin O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Rosinidin O-hexoside concentration: increase (FC = 10.91)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of rosinidin O-hexoside levels compared with control group.
Sweroside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Sweroside concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of sweroside levels compared with control group.
Swertiamarin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Swertiamarin concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of swertiamarin levels compared with control group.
Tricetin O-malonylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricetin O-malonylhexoside concentration: increase (FC = 5.42)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of tricetin O-malonylhexoside levels compared with control group.
Tricin 4'-O-(syringyl alcohol) ether 5-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin 4'-O-(syringyl alcohol) ether 5-O-hexoside concentration: increase (FC = 14.53)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of tricin 4'-O-(syringyl alcohol) ether 5-O-hexoside levels compared with control group.
Tricin 4'-O-syringyl alcohol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin 4'-O-syringyl alcohol concentration: decrease (FC = 21)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tricin 4'-O-syringyl alcohol levels compared with control group.
Tricin 5-O-feruloylhexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin 5-O-feruloylhexoside concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tricin 5-O-feruloylhexoside levels compared with control group.
Vanillic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Vanillic acid concentration: increase (FC = 10.40)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of vanillic acid levels compared with control group.
Homogeneous non-metal compounds
L-(+)-Homoarginine HCl		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	L-(+)-Homoarginine HCl concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of L-(+)-homoarginine HCl levels compared with control group.
Phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phosphate concentration: increase (FC = 2.61)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of phosphate levels compared with control group.
Lipid-related molecules
9-HpOTrE		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	9-HpOTrE concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 9-HpOTrE levels compared with control group.
Aspartic acid di-O-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Aspartic acid di-O-glucoside concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of aspartic acid di-O-glucoside levels compared with control group.
Chrysoeriol O-hexosyl-O-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysoeriol O-hexosyl-O-hexoside concentration: increase (FC = 5.78)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of chrysoeriol O-hexosyl-O-hexoside levels compared with control group.
Chrysoeriol O-hexosyl-O-rutinoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chrysoeriol O-hexosyl-O-rutinoside concentration: decrease (FC = 3.10)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of chrysoeriol O-hexosyl-O-rutinoside levels compared with control group.
MAG (18:2) isomer1		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	MAG (18:2) isomer1 concentration: decrease (FC = 0.42)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of MAG (18:2) isomer1 levels compared with control group.
Protocatechuic acid O-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Protocatechuic acid O-glucoside concentration: increase (FC = 32.74)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of protocatechuic acid O-glucoside levels compared with control group.
Pyridoxine O-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Pyridoxine O-glucoside concentration: increase (FC = 11.08)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of pyridoxine O-glucoside levels compared with control group.
Lipids and lipid-like molecules
1,18-Octadecanediol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	1,18-Octadecanediol concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 1,18-octadecanediol levels compared with control group.
11Z-Eicosenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	11Z-Eicosenoic acid concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 11Z-eicosenoic acid levels compared with control group.
12,13-Epoxy-9-octadecenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	12,13-Epoxy-9-octadecenoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 12,13-epoxy-9-octadecenoic acid levels compared with control group.
13(S)-HpOTrE (gamma)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	13(S)-HpOTrE (gamma) concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 13(S)-HpOTrE (gamma) levels compared with control group.
2,3-Dimethylsuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2,3-Dimethylsuccinic acid concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 2,3-dimethylsuccinic acid levels compared with control group.
2-Isopropylmalic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2-Isopropylmalic acid concentration: decrease (FC = 0.23)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 2-isopropylmalic acid levels compared with control group.
2-Methylglutaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	2-Methylglutaric acid concentration: decrease (FC = 0.22)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 2-methylglutaric acid levels compared with control group.
9,10-Epoxy-12-octadecenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	9,10-Epoxy-12-octadecenoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 9,10-epoxy-12-octadecenoic acid levels compared with control group.
9-HOTrE		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	9-HOTrE concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 9-HOTrE levels compared with control group.
Adipic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Adipic acid concentration: decrease (FC = 0.21)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of adipic acid levels compared with control group.
Aminocaproic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Aminocaproic acid concentration: increase (FC = 2.59)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of aminocaproic acid levels compared with control group.
Beta-Caryophyllene		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Beta-Caryophyllene concentration: increase (FC = 2.74)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of beta-caryophyllene levels compared with control group.
Caffeic acid phenethyl ester		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Caffeic acid phenethyl ester concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of caffeic acid phenethyl ester levels compared with control group.
Curdione		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Curdione concentration: decrease (FC = 0.17)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of curdione levels compared with control group.
Geniposide		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Geniposide concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of geniposide levels compared with control group.
Lysopc 15:1		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Lysopc 15:1 concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysopc 15:1 levels compared with control group.
LysoPC(14:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(14:0/0:0) concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(14:0/0:0) levels compared with control group.
LysoPC(15:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(15:0/0:0) concentration: decrease (FC = 0.43)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(15:0/0:0) levels compared with control group.
LysoPC(18:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(18:0/0:0) concentration: decrease (FC = 0.32)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(18:0/0:0) levels compared with control group.
LysoPC(18:1(9Z))		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(18:1(9Z)) concentration: decrease (FC = 0.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(18:1(9Z)) levels compared with control group.
LysoPC(18:2(9Z,12Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(18:2(9Z,12Z)/0:0) concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(18:2(9Z,12Z)/0:0) levels compared with control group.
LysoPC(18:3(6Z,9Z,12Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(18:3(6Z,9Z,12Z)/0:0) concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(18:3(6Z,9Z,12Z)/0:0) levels compared with control group.
LysoPC(20:4(5Z,8Z,11Z,14Z))		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPC(20:4(5Z,8Z,11Z,14Z)) concentration: decrease (FC = 0.29)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPC(20:4(5Z,8Z,11Z,14Z)) levels compared with control group.
LysoPE(14:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPE(14:0/0:0) concentration: decrease (FC = 0.44)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPE(14:0/0:0) levels compared with control group.
LysoPE(18:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPE(18:0/0:0) concentration: decrease (FC = 0.34)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPE(18:0/0:0) levels compared with control group.
LysoPE(18:1(9Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPE(18:1(9Z)/0:0) concentration: decrease (FC = 0.46)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPE(18:1(9Z)/0:0) levels compared with control group.
LysoPE(18:2(9Z,12Z)/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	LysoPE(18:2(9Z,12Z)/0:0) concentration: decrease (FC = 0.46)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of lysoPE(18:2(9Z,12Z)/0:0) levels compared with control group.
Methylsuccinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methylsuccinic acid concentration: decrease (FC = 0.30)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of methylsuccinic acid levels compared with control group.
MG(18:3(6Z,9Z,12Z)/0:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	MG(18:3(6Z,9Z,12Z)/0:0/0:0) concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of MG(18:3(6Z,9Z,12Z)/0:0/0:0) levels compared with control group.
MG(18:4(6Z,9Z,12Z,15Z)/0:0/0:0)		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	MG(18:4(6Z,9Z,12Z,15Z)/0:0/0:0) concentration: increase (FC = 6.36)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of MG(18:4(6Z,9Z,12Z,15Z)/0:0/0:0) levels compared with control group.
Octadeca-11E,13E,15Z-trienoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Octadeca-11E,13E,15Z-trienoic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of octadeca-11E,13E,15Z-trienoic acid levels compared with control group.
Phytol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phytol concentration: increase (FC = 3.58)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of phytol levels compared with control group.
Organic acids
N-Feruloyl putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Feruloyl putrescine concentration: decrease (FC = 0.22)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-feruloyl putrescine levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Feruloyl putrescine concentration: decrease (FC = 0.29)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-feruloyl putrescine levels compared with control group.
N-hexosyl-p-coumaroyl putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-hexosyl-p-coumaroyl putrescine concentration: increase (FC = 0.23)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of N-hexosyl-p-coumaroyl putrescine levels compared with control group.
N-Sinapoyl putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Sinapoyl putrescine concentration: decrease (FC = 268888.89)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-sinapoyl putrescine levels compared with control group.
Organic acids and derivatives
3-(2-Naphthyl)-D-alanine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	3-(2-Naphthyl)-D-alanine concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 3-(2-naphthyl)-D-alanine levels compared with control group.
5-Aminopentanoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5-Aminopentanoic acid concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 5-aminopentanoic acid levels compared with control group.
Aspartic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Aspartic acid concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of aspartic acid levels compared with control group.
Betaine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Betaine concentration: decrease (FC = 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of betaine levels compared with control group.
Creatine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Creatine concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of creatine levels compared with control group.
Dehydrocrepenynic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Dehydrocrepenynic acid concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of dehydrocrepenynic acid levels compared with control group.
Glutaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Glutaric acid concentration: decrease (FC = 0.34)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of glutaric acid levels compared with control group.
N-Acetyl-L-tyrosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Acetyl-L-tyrosine concentration: decrease (FC = 0.22)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-acetyl-L-tyrosine levels compared with control group.
N-Acetyltryptophan		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Acetyltryptophan concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-acetyltryptophan levels compared with control group.
N-Caffeoyl putrescine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Caffeoyl putrescine concentration: decrease (FC = 11.85)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-caffeoyl putrescine levels compared with control group.
Phenylacetylglutamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phenylacetylglutamine concentration: decrease (FC = 0.07)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of phenylacetylglutamine levels compared with control group.
Proline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Proline concentration: decrease (FC = 0.35)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of proline levels compared with control group.
S-Methylglutathione		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	S-Methylglutathione concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of s-methylglutathione levels compared with control group.
Sinapoyl malate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Sinapoyl malate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of sinapoyl malate levels compared with control group.
Organic nitrogen compounds
Carnitine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Carnitine concentration: increase (FC = 2.92)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of carnitine levels compared with control group.
Organic oxygen compounds
1,3-Dicaffeoylquinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	1,3-Dicaffeoylquinic acid concentration: decrease (FC = 0.41)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 1,3-dicaffeoylquinic acid levels compared with control group.
1-O-beta-D-Glucopyranosyl sinapate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	1-O-beta-D-Glucopyranosyl sinapate concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 1-o-beta-D-Glucopyranosyl sinapate levels compared with control group.
1-O-p-Coumaroyl quinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	1-O-p-Coumaroyl quinic acid concentration: decrease (FC = 0.47)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 1-o-p-Coumaroyl quinic acid levels compared with control group.
3-O-p-Coumaroyl quinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	3-O-p-Coumaroyl quinic acid concentration: increase (FC = 24.27)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 3-o-p-coumaroyl quinic acid levels compared with control group.
Acetyl-N-formyl-5-methoxykynurenamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Acetyl-N-formyl-5-methoxykynurenamine concentration: decrease (FC = 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of acetyl-N-formyl-5-methoxykynurenamine levels compared with control group.
Beta-D-Glucosamine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Beta-D-Glucosamine concentration: increase (FC = 3.17)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of beta-D-glucosamine levels compared with control group.
D-Pantothenic dcid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	D-Pantothenic dcid concentration: decrease (FC = 0.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of D-Pantothenic dcid levels compared with control group.
Homovanilloyl quinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Homovanilloyl quinic acid concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of homovanilloyl quinic acid levels compared with control group.
L-Kynurenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	L-Kynurenine concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of L-kynurenine levels compared with control group.
Methyl chlorogenate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methyl chlorogenate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of methyl chlorogenate levels compared with control group.
MGMG (18:2) isomer2		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	MGMG (18:2) isomer2 concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of MGMG (18:2) isomer2 levels compared with control group.
N'-Formylkynurenine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N'-Formylkynurenine concentration: decrease (FC = 0.45)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N'-formylkynurenine levels compared with control group.
N-Acetyl-glucosamine 1-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	N-Acetyl-glucosamine 1-phosphate concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of N-acetyl-glucosamine 1-phosphate levels compared with control group.
O-p-Coumaroyl quinic acid O-rutinoside derivative		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	O-p-Coumaroyl quinic acid O-rutinoside derivative concentration: decrease (FC = 0.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of o-p-Coumaroyl quinic acid O-rutinoside derivative levels compared with control group.
Peonidin 3-monoglucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Peonidin 3-monoglucoside concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of peonidin 3-monoglucoside levels compared with control group.
Sucralose		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Sucralose concentration: decrease (FC = 0.07)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of sucralose levels compared with control group.
Tricin 4'-O-beta-guaiacylglycerol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin 4'-O-beta-guaiacylglycerol concentration: decrease (FC = 0.09)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tricin 4'-O-beta-guaiacylglycerol levels compared with control group.
Tricin 7-O-beta-guaiacylglycerol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin 7-O-beta-guaiacylglycerol concentration: increase (FC = 0.25)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of tricin 7-O-beta-guaiacylglycerol levels compared with control group.
Tricin O-malonyl shikimic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin O-malonyl shikimic acid concentration: decrease (FC = 2.14)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tricin O-malonyl shikimic acid levels compared with control group.
Organoheterocyclic compounds
5-Hydroxyindoleacetic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5-Hydroxyindoleacetic acid concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 5-hydroxyindoleacetic acid levels compared with control group.
5-Methylcytosine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5-Methylcytosine concentration: increase (FC = 30.43)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 5-methylcytosine levels compared with control group.
6-Methylmercaptopurine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	6-Methylmercaptopurine concentration: decrease (FC = 0.50)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 6-methylmercaptopurine levels compared with control group.
Biotin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Biotin concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of biotin levels compared with control group.
Caffeine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Caffeine concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of caffeine levels compared with control group.
Cotinine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Cotinine concentration: decrease (FC = 0.39)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of cotinine levels compared with control group.
Delta-Hexanolactone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Delta-Hexanolactone concentration: decrease (FC = 0.26)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of delta-Hexanolactone levels compared with control group.
Kynurenic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Kynurenic acid concentration: decrease (FC = 0.24)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of kynurenic acid levels compared with control group.
Methyl nicotinate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methyl nicotinate concentration: decrease (FC = 0.26)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of methyl nicotinate levels compared with control group.
Paraxanthine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Paraxanthine concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of paraxanthine levels compared with control group.
Pyridoxine		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Pyridoxine concentration: increase (FC = 2.62)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of pyridoxine levels compared with control group.
Pyridoxine 5'-phosphate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Pyridoxine 5'-phosphate concentration: increase (FC = 3.74)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of pyridoxine 5'-phosphate levels compared with control group.
Theophylline		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Theophylline concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of theophylline levels compared with control group.
Tryptophan		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tryptophan concentration: decrease (FC = 0.37)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tryptophan levels compared with control group.
Phenylpropanoids and polyketides
(+)-Gallocatechin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	(+)-Gallocatechin concentration: increase (FC = 391481.48)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of (+)-gallocatechin levels compared with control group.
(-)-Epiafzelechin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	(-)-Epiafzelechin concentration: increase (FC = 5.27)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of (-)-epiafzelechin levels compared with control group.
(-)-Epigallocatechin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	(-)-Epigallocatechin concentration: increase (FC = 474444.44)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of (-)-epigallocatechin levels compared with control group.
3-(3,4-Dimethoxyphenyl)-2-propenoic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	3-(3,4-Dimethoxyphenyl)-2-propenoic acid concentration: increase (FC = 22.12)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 3-(3,4-dimethoxyphenyl)-2-propenoic acid levels compared with control group.
4,5,7-Trihydroxyflavanone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	4,5,7-Trihydroxyflavanone concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 4,5,7-trihydroxyflavanone levels compared with control group.
4-Hydroxycinnamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	4-Hydroxycinnamic acid concentration: increase (FC = 18.09)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 4-hydroxycinnamic acid levels compared with control group.
4-Methoxycinnamic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	4-Methoxycinnamic acid concentration: increase (FC = 4.05)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 4-methoxycinnamic acid levels compared with control group.
5,7-Dihydroxy-3',4',5'-trimethoxyflavone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5,7-Dihydroxy-3',4',5'-trimethoxyflavone concentration: increase (FC = 2.37)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 5,7-dihydroxy-3',4',5'-trimethoxyflavone levels compared with control group.
5,7-Dihydroxychromone		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	5,7-Dihydroxychromone concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 5,7-dihydroxychromone levels compared with control group.
6''-Acetylapiin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	6''-Acetylapiin concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 6''-acetylapiin levels compared with control group.
7,8-Dihydroxy-2H-chromen-2-one		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	7,8-Dihydroxy-2H-chromen-2-one concentration: decrease (FC = 0.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of 7,8-dihydroxy-2H-chromen-2-one levels compared with control group.
Ampelopsin D		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Ampelopsin D concentration: increase (FC = 79555.56)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of ampelopsin D levels compared with control group.
Astilbin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Astilbin concentration: increase (FC = 47.93)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of astilbin levels compared with control group.
Biorobin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Biorobin concentration: decrease (FC = 0.38)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of biorobin levels compared with control group.
Butin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Butin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of butin levels compared with control group.
Caffeic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Caffeic acid concentration: decrease (FC = 0.40)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of caffeic acid levels compared with control group.
Caftaric acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Caftaric acid concentration: decrease (FC = 0.13)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of caftaric acid levels compared with control group.
Chalconaringenin		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chalconaringenin concentration: increase (FC = 9.25)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of chalconaringenin levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Chalconaringenin concentration: increase (FC = 2.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of chalconaringenin levels compared with control group.
Cosmosiin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Cosmosiin concentration: decrease (FC = 0.48)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of cosmosiin levels compared with control group.
Delphinidin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Delphinidin concentration: decrease (FC = 0.45)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of delphinidin levels compared with control group.
Desmethylxanthohumol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Desmethylxanthohumol concentration: decrease (FC = 0.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of desmethylxanthohumol levels compared with control group.
Dihydro-kempferol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Dihydro-kempferol concentration: increase (FC = 65.64)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of dihydro-kempferol levels compared with control group.
Epicatechin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Epicatechin concentration: increase (FC = 59370.37)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of epicatechin levels compared with control group.
Esculin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Esculin concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of esculin levels compared with control group.
Ethyl caffeate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Ethyl caffeate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of ethyl caffeate levels compared with control group.
Ferulic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Ferulic acid concentration: increase (FC = 4.89)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of ferulic acid levels compared with control group.
Isoferulic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isoferulic acid concentration: increase (FC = 4.40)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isoferulic acid levels compared with control group.
Isorhamnetin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isorhamnetin concentration: increase (FC = 44407.41)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isorhamnetin levels compared with control group.
Isorhamnetin-3-O-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Isorhamnetin-3-O-glucoside concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of isorhamnetin-3-O-glucoside levels compared with control group.
Kaempferol-3-O-robinobioside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Kaempferol-3-O-robinobioside concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of kaempferol-3-O-robinobioside levels compared with control group.
Luteolin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Luteolin concentration: decrease (FC = 0.31)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of luteolin levels compared with control group.
Methyl ferulate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methyl ferulate concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of methyl ferulate levels compared with control group.
Methyl-p-coumarate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Methyl-p-coumarate concentration: increase (FC = 12.81)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of methyl-p-coumarate levels compared with control group.
Morin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Morin concentration: increase (FC = 11.43)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of morin levels compared with control group.
Myricetin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Myricetin concentration: increase (FC = 239185.19)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of myricetin levels compared with control group.
Naringenin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Naringenin concentration: increase (FC = 8.33)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of naringenin levels compared with control group.
Naringin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Naringin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of naringin levels compared with control group.
Narirutin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Narirutin concentration: increase (FC = 93259.26)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of narirutin levels compared with control group.
Ononin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Ononin concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of ononin levels compared with control group.
Pelargonidin 3-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Pelargonidin 3-glucoside concentration: increase (FC = 20)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of pelargonidin 3-glucoside levels compared with control group.
Phloretin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phloretin concentration: increase (FC = 14888.89)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of phloretin levels compared with control group.
Phlorizin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Phlorizin concentration: increase (FC = 12.16)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of phlorizin levels compared with control group.
Quercetin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Quercetin concentration: increase (FC = 10.28)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of quercetin levels compared with control group.
Rosmarinic acid		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Rosmarinic acid concentration: decrease (FC = 0.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of rosmarinic acid levels compared with control group.
Scopoletin		Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair (1)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Scopoletin concentration: decrease (FC = 0.32)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of scopoletin levels compared with control group.
Regulating Pair (2)	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Scopoletin concentration: increase (FC = 8.00)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of scopoletin levels compared with control group.
Tectorigenin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tectorigenin concentration: increase (FC = 2.18)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of tectorigenin levels compared with control group.
Tricin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Tricin concentration: decrease (FC = 0.21)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of tricin levels compared with control group.
Xanthotoxol		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Xanthotoxol concentration: decrease (FC = 0.01)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of xanthotoxol levels compared with control group.
Phenylpropanoids/polyketides
7-Hydroxycoumarin-beta-rhamnoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	7-Hydroxycoumarin-beta-rhamnoside concentration: increase (FC = 0.24)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of 7-hydroxycoumarin-beta-rhamnoside levels compared with control group.
Apigenin O-hexosyl-O-pentoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Apigenin O-hexosyl-O-pentoside concentration: decrease (FC = 0.27)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of apigenin O-hexosyl-O-pentoside levels compared with control group.
Cyanin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Cyanin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of cyanin levels compared with control group.
D(+)-Melezitose O-rhamnoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	D(+)-Melezitose O-rhamnoside concentration: decrease (FC = 2.74)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of d(+)-Melezitose O-rhamnoside levels compared with control group.
Gallocatechin-catechin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Gallocatechin-catechin concentration: decrease (FC = 187407.41)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of gallocatechin-catechin levels compared with control group.
Hydroxy-methoxycinnamate		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Hydroxy-methoxycinnamate concentration: increase (FC = 0.17)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of hydroxy-methoxycinnamate levels compared with control group.
Kaempferol-3-O-rhamnoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Kaempferol-3-O-rhamnoside concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of kaempferol-3-O-rhamnoside levels compared with control group.
Naringenin 7-O-glucoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Naringenin 7-O-glucoside concentration: decrease
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of naringenin 7-O-glucoside levels compared with control group.
Quercetin 5-O-malonylhexosyl-hexoside		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Quercetin 5-O-malonylhexosyl-hexoside concentration: decrease (FC = 2.49)
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the decrease of quercetin 5-O-malonylhexosyl-hexoside levels compared with control group.
Skimmin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Skimmin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of skimmin levels compared with control group.
Taxifolin		Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s)
Detailed Information	Metabo Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair		[1]
Introduced Variation	Overexpression of AN2
Induced Change	Taxifolin concentration: increase
Summary	Introduced Variation Induced Change
Disease Status	Healthy individual
Details	It is reported that overexpression of AN2 leads to the increase of taxifolin levels compared with control group.

References
1	Comprehensive Influences of Overexpression of a MYB Transcriptor Regulating Anthocyanin Biosynthesis on Transcriptome and Metabolome of Tobacco Leaves. Int J Mol Sci. 2019 Oct 16;20(20):5123.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.