Details of Protein
| General Information of Protein (ID: PRT00562) | |||||
|---|---|---|---|---|---|
| Name | Signal-regulated kinase 1 (ERK1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
MAP kinase 3; MAPK 3; ERT2; Extracellular signal-regulated kinase 1; ERK-1; Insulin-stimulated MAP2 kinase; MAP kinase isoform p44; p44-MAPK; Microtubule-associated protein 2 kinase; p44-ERK1; MAPK3; ERK1; PRKM3
|
||||
| Gene Name | MAPK3 | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.7.11.24 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL KELIFQETARFQPGVLEAP |
||||
| Structure | |||||
| Function | Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| UDP glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | UDP glucose addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute lymphoblastic leukemia [ICD-11: 2B33] | |||||
| Details | It is reported that UDP glucose addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Uridine 5'-diphosphate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Uridine 5'-diphosphate addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute lymphoblastic leukemia [ICD-11: 2B33] | |||||
| Details | It is reported that uridine 5'-diphosphate addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Homogeneous metal compounds | ||||||
| Calcium | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Calcium addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that calcium addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Gadolinium | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Gadolinium addition (0.17 hour) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that gadolinium addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Magnesium | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Magnesium addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that magnesium addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Lipids and lipid-like molecules | ||||||
| 1-Oleoyl LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 1-Oleoyl LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 1-oleoyl LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 1-Palmitoyl LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 1-Palmitoyl LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 1-palmitoyl LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 1-Stearoyl LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 1-Stearoyl LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 1-stearoyl LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 12-HETE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[4] | ||||
| Introduced Variation | 12-HETE addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 12-HETE addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 2-Arachidonoyl-LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 2-Arachidonoyl-LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 2-arachidonoyl-LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 2-Linoleoyl LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 2-Linoleoyl LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 2-linoleoyl LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 2-Oleoyl LPI | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | 2-Oleoyl LPI addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that 2-oleoyl LPI addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 2-Oleoyl-LPA | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[5] | ||||
| Introduced Variation | 2-Oleoyl-LPA addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that 2-oleoyl-LPA addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| 5-oxo-ETE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[6] | ||||
| Introduced Variation | 5-oxo-ETE addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Pulmonary hypertension [ICD-11: BB01] | |||||
| Details | It is reported that 5-oxo-ETE addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Hydroxyoctanoic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[7] | ||||
| Introduced Variation | Hydroxyoctanoic acid addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Diabetic acidosis [ICD-11: 5A22] | |||||
| Details | It is reported that hydroxyoctanoic acid addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| LysoPA(18:1(9Z)/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[8] | ||||
| Introduced Variation | LysoPA(18:1(9Z)/0:0) addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Idiopathic pulmonary fibrosis [ICD-11: CB03] ... | |||||
| Details | It is reported that lysoPA(18:1(9Z)/0:0) addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| LysoPG(16:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | LysoPG(16:0/0:0) addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that lysoPG(16:0/0:0) addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| LysoPS(18:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[9] | ||||
| Introduced Variation | LysoPS(18:0/0:0) addition (0.5 hour) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that lysoPS(18:0/0:0) addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[10] | ||||
| Introduced Variation | LysoPS(18:0/0:0) addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Anaphylaxis [ICD-11: 4A84] | |||||
| Details | It is reported that lysoPS(18:0/0:0) addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Resolvin E1 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[11] | ||||
| Introduced Variation | Resolvin E1 addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Coronary artery disease [ICD-11: BA80] | |||||
| Details | It is reported that resolvin E1 addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[12] | ||||
| Introduced Variation | Arginine decrease (72 hours) | |||||
| Induced Change | MAPK3 protein abundance levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Leiomyosarcoma [ICD-11: 2B58] | |||||
| Details | It is reported that arginine decrease causes the increase of MAPK3 protein abundance compared with control group. | |||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[13] | ||||
| Introduced Variation | Leucine addition (5 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that leucine addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| N-Arachidonoylglycine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[14] | ||||
| Introduced Variation | N-Arachidonoylglycine addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Endometriosis [ICD-11: GA10] | |||||
| Details | It is reported that N-arachidonoylglycine addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Phenylalanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[15] | ||||
| Introduced Variation | Phenylalanine addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Diabetes mellitus [ICD-11: 5A14] | |||||
| Details | It is reported that phenylalanine addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Organic nitrogen compounds | ||||||
| Anandamide | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[14] | ||||
| Introduced Variation | Anandamide addition (0.083 hour) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Endometriosis [ICD-11: GA10] | |||||
| Details | It is reported that anandamide addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[16] | ||||
| Introduced Variation | Glucose addition (50 hours) | |||||
| Induced Change | MAPK3 protein abundance levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Brain cancer [ICD-11: 2A00] | |||||
| Details | It is reported that glucose addition causes the increase of MAPK3 protein abundance compared with control group. | |||||
| Organoheterocyclic compounds | ||||||
| Tryptophan | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[15] | ||||
| Introduced Variation | Tryptophan addition (0.08 hours) | |||||
| Induced Change | MAPK3 protein phosphorylation levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Diabetes mellitus [ICD-11: 5A14] | |||||
| Details | It is reported that tryptophan addition causes the increase of MAPK3 protein phosphorylation compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

