Details of Protein

General Information of Protein (ID: PRT00847)
Name Solute carrier family 25 member 33 (SLC25A33)
Synonyms   Click to Show/Hide Synonyms of This Protein
Bone marrow stromal cell mitochondrial carrier protein; BMSC-MCP; HuBMSC-MCP; Protein PNC1; SLC25A33
Gene Name SLC25A33 Gene ID
84275
UniProt ID
Q9BSK2
Family Mitochondrial carrier (MC)
TC Number   TC: 2.A.29.10.7  (Click to Show/Hide the Complete TC Tree)
The Mitochondrial Carrier (MC) Family
.
TC: 2.A.29.10.7
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS
GAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN
GIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQT
EGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAA
ALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP
NTAIVLSTYELIVYLLEDRTQ
Function Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Transports preferentially uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism. Also transports guanine but not adenine (deoxy)nucleotides. Is inhibited strongly by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, mersalyl acid, p-hydroxymercuribenzoate). Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration. Upon INS or IGF1 stimulation regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, the ratio of mitochondria-to nuclear-encoded components of the electron transport chain resulting in control of mitochondrial ROS production. Participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            dCTP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dCTP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dCTP levels compared with control group.
            dGTP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dGTP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dGTP levels compared with control group.
            dTDP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dTDP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dTDP levels compared with control group.
            dUTP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dUTP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dUTP levels compared with control group.
            Guanosine diphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Guanosine diphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of guanosine diphosphate levels compared with control group.
            Guanosine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Guanosine triphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of guanosine triphosphate levels compared with control group.
            Inosine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Inosine triphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of inosine triphosphate levels compared with control group.
            Uridine 5'-diphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Uridine 5'-diphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of uridine 5'-diphosphate levels compared with control group.
            Uridine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Uridine triphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of uridine triphosphate levels compared with control group.
      Homogeneous non-metal compounds
            Triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Triphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of triphosphate levels compared with control group.
      Organic oxygen compounds
            Cytidine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Cytidine triphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of cytidine triphosphate levels compared with control group.
            dCDP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dCDP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dCDP levels compared with control group.
      Organoheterocyclic compounds
            Chlordiazepoxide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change Chlordiazepoxide concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of chlordiazepoxide levels compared with control group.
      Phenylpropanoids and polyketides
            dGDP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Recombinant protein addition of SLC25A33
                      Induced Change dGDP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC25A33 leads to the increase of dGDP levels compared with control group.
References
1 The human SLC25A33 and SLC25A36 genes of solute carrier family 25 encode two mitochondrial pyrimidine nucleotide transporters. J Biol Chem. 2014 Nov 28;289(48):33137-48.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.