Details of Protein

General Information of Protein (ID: PRT00875)
Name Isoprenylcysteine carboxylmethyltransferase (ICMT)
Synonyms   Click to Show/Hide Synonyms of This Protein
Protein-S-isoprenylcysteine O-methyltransferase; Prenylated protein carboxyl methyltransferase; PPMT; Prenylcysteine carboxyl methyltransferase; pcCMT; ICMT; PCCMT
Gene Name ICMT Gene ID
23463
UniProt ID
O60725
Family Transferases (EC 2)
EC Number   EC: 2.1.1.100  (Click to Show/Hide the Complete EC Tree)
Transferase
Methylase
Methyltransferase
EC: 2.1.1.100
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Function Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change ATP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Prostate cancer [ICD-11: 2C82]
                      Details It is reported that inhibition of ICMT leads to the decrease of ATP levels compared with control group.
            Guanosine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Guanosine triphosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Prostate cancer [ICD-11: 2C82]
                      Details It is reported that inhibition of ICMT leads to the decrease of guanosine triphosphate levels compared with control group.
            Uridine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Uridine triphosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Prostate cancer [ICD-11: 2C82]
                      Details It is reported that inhibition of ICMT leads to the decrease of uridine triphosphate levels compared with control group.
      Organic acids and derivatives
            Asparagine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Asparagine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of ICMT leads to the decrease of asparagine levels compared with control group.
            Aspartic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of ICMT leads to the decrease of aspartic acid levels compared with control group.
            Citric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Citric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of citric acid levels compared with control group.
            Glutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Glutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of ICMT leads to the decrease of glutamic acid levels compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Glutamine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of ICMT leads to the decrease of glutamine levels compared with control group.
            Malic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Malic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of malic acid levels compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Oxoglutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of oxoglutaric acid levels compared with control group.
            Pyruvic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Pyruvic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of pyruvic acid levels compared with control group.
            Succinic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of succinic acid levels compared with control group.
      Organic oxygen compounds
            Cytidine triphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Cytidine triphosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Prostate cancer [ICD-11: 2C82]
                      Details It is reported that inhibition of ICMT leads to the decrease of cytidine triphosphate levels compared with control group.
            Glycerol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cysmethynil) of ICMT
                      Induced Change Glycerol concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that inhibition of ICMT leads to the decrease of glycerol levels compared with control group.
References
1 Isoprenylcysteine carboxylmethyltransferase regulates mitochondrial respiration and cancer cell metabolism. Oncogene. 2015 Jun;34(25):3296-304.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.