Details of Protein
| General Information of Protein (ID: PRT00506) | |||||
|---|---|---|---|---|---|
| Name | PPAR-gamma coactivator 1-alpha (PPARGC1A) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
PGC-1-alpha; Peroxisome proliferator-activated receptor gamma coactivator 1-alpha; PPARGC-1-alpha; Ppargc1a; Pgc1; Pgc1a; Ppargc1
|
||||
| Gene Name | Ppargc1a | Gene ID | |||
| UniProt ID | |||||
| Family | Transcriptional coactivator (TC) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQS
EIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNE ASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPA IVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKK SHTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPP HKANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQGSHSTKKGPEQSELYAQLSKS SGLSRGHEERKTKRPSLRLFGDHDYCQSLNSKTDILINISQELQDSRQLDFKDASCDWQG HICSSTDSGQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPCQAVFDDKSDKT SELRDGDFSNEQFSKLPVFINSGLAMDGLFDDSEDESDKLSYPWDGTQPYSLFDVSPSCS SFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCY YYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEAYEHERLKRDEYRKEHEKRESER AKQRERQKQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFIT YRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD SLDFDSLLKEAQRSLRR |
||||
| Structure | |||||
| Function | Transcriptional coactivator for steroid receptors and nuclear receptors. Greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis. Plays an essential role in metabolic reprogramming in response to dietary availability through coordination of the expression of a wide array of genes involved in glucose and fatty acid metabolism. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner. Also involved in the integration of the circadian rhythms and energy metabolism. Required for oscillatory expression of clock genes, such as ARNTL/BMAL1 and NR1D1, through the coactivation of RORA and RORC, and metabolic genes, such as PDK4 and PEPCK. Isoform 4 specifically activates the expression of IGF1 and suppresses myostatin expression in skeletal muscle leading to muscle fiber hypertrophy. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| NADP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | NADP concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the decrease of NADP levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Alanine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the increase of alanine levels compared with control group. | |||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Arginine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the increase of arginine levels compared with control group. | |||||
| Ergothioneine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | Ergothioneine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the decrease of ergothioneine levels compared with control group. | |||||
| Glutamic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Glutamic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the decrease of glutamic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Glutamic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the increase of glutamic acid levels compared with control group. | |||||
| Glycine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Glycine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the increase of glycine levels compared with control group. | |||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Leucine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the decrease of leucine levels compared with control group. | |||||
| Lysine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Lysine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the increase of lysine levels compared with control group. | |||||
| N-Acetylaspartylglutamic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | N-Acetylaspartylglutamic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the increase of N-acetylaspartylglutamic acid levels compared with control group. | |||||
| Oxidized glutathione | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | Oxidized glutathione concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the increase of oxidized glutathione levels compared with control group. | |||||
| s-Hexylglutathione | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | s-Hexylglutathione concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the decrease of s-hexylglutathione levels compared with control group. | |||||
| Serine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | Serine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the increase of serine levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Serine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the decrease of serine levels compared with control group. | |||||
| Threonine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ppargc1a | |||||
| Induced Change | Threonine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Congestive heart failure [ICD-11: BD10] | |||||
| Details | It is reported that knockout of Ppargc1a leads to the increase of threonine levels compared with control group. | |||||
| Valine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Overexpression of Ppargc1a | |||||
| Induced Change | Valine concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of Ppargc1a leads to the decrease of valine levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

