Details of Protein

General Information of Protein (ID: PRT00067)
Name DAN domain family member 5 (DAND5)
Synonyms   Click to Show/Hide Synonyms of This Protein
Cerberus-like protein 2; Cerl-2; Cysteine knot superfamily 1, BMP antagonist 3; Gremlin-3; DAND5; CER2; CKTSF1B3; GREM3; SP1
Gene Name DAND5 Gene ID
199699
UniProt ID
Q8N907
Family Bone morphogenic antagonist (BMA)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSW
KAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRL
RNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLI
EGCHCSPKA
Function Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipid-related molecules
            C24:1-ceramide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change C24:1-ceramide concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of C24:1-ceramide levels compared with control group.
            Ceramide C18:1 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide C18:1 concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of ceramide c18:1 levels compared with control group.
            Ceramide C24:1 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide C24:1 concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of ceramide c24:1 levels compared with control group.
      Lipids and lipid-like molecules
            Ceramide(d18:1/14:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide(d18:1/14:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of ceramide(d18:1/14:0) levels compared with control group.
            Ceramide(d18:1/16:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide(d18:1/16:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of ceramide(d18:1/16:0) levels compared with control group.
            Ceramide(d18:1/23:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide(d18:1/23:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of ceramide(d18:1/23:0) levels compared with control group.
            Ceramide(d18:1/24:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Ceramide(d18:1/24:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of ceramide(d18:1/24:0) levels compared with control group.
            CerP(d18:1/16:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change CerP(d18:1/16:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of cerP(d18:1/16:0) levels compared with control group.
            GlcCer(d18:1/18:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change GlcCer(d18:1/18:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of glcCer(d18:1/18:0) levels compared with control group.
            Sphingosine 1-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Sphingosine 1-phosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of sphingosine 1-phosphate levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Sphingosine 1-phosphate concentration: increase (FC = 5.09)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of sphingosine 1-phosphate levels compared with control group.
      Organic nitrogen compounds
            Sphingosine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Sphingosine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the decrease of sphingosine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of DAND5
                      Induced Change Sphingosine concentration: increase (FC = 1.82)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of DAND5 leads to the increase of sphingosine levels compared with control group.
References
1 Golgi alkaline ceramidase regulates cell proliferation and survival by controlling levels of sphingosine and S1P. FASEB J. 2006 Sep;20(11):1813-25.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.