Details of Protein

General Information of Protein (ID: PRT01174)
Name HepG2 glucose transporter (SLC2A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter; SLC2A1; GLUT1
Gene Name SLC2A1 Gene ID
6513
UniProt ID
P11166
Family Sugar transporter (ST)
TC Number   TC: 2.A.1.1.28  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Sugar Porter (SP) Family
TC: 2.A.1.1.28
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
Structure
1SUK ; 4PYP ; 5EQG ; 5EQH ; 5EQI ; 6THA
Function Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            2-Deoxyglucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC2A1
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC2A1 leads to the increase of 2-deoxyglucose levels compared with control group.
      Organic oxygen compounds
            Dihydroartemisinin Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC2A1
                      Induced Change Dihydroartemisinin concentration: increase (FC = 100)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC2A1 leads to the increase of dihydroartemisinin levels compared with control group.
            Fructose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockdown (siRNA) of SLC2A1
                      Induced Change Fructose concentration: decrease (FC = 0.65)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Insulin-resistance syndromes [ICD-11: 5A44]
                      Details It is reported that knockdown of SLC2A1 leads to the decrease of fructose levels compared with control group.
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (Gly286Asp) of SLC2A1
                      Induced Change Glucose concentration: decrease (FC = 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary haemolytic anaemia [ICD-11: 3A10]
                      Details It is reported that mutation (Gly286Asp) of SLC2A1 leads to the decrease of glucose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (Ile435; Ile436) of SLC2A1
                      Induced Change Glucose concentration: decrease (FC = 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary haemolytic anaemia [ICD-11: 3A10]
                      Details It is reported that mutation (Ile435 or Ile436) of SLC2A1 leads to the decrease of glucose levels compared with control group.
            Methyl beta-D-glucopyranoside Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (Gly286Asp) of SLC2A1
                      Induced Change Methyl beta-D-glucopyranoside concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary haemolytic anaemia [ICD-11: 3A10]
                      Details It is reported that mutation (Gly286Asp) of SLC2A1 leads to the decrease of methyl beta-D-glucopyranoside levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S290A) of SLC2A1
                      Induced Change Methyl beta-D-glucopyranoside concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary haemolytic anaemia [ICD-11: 3A10]
                      Details It is reported that mutation (S290A) of SLC2A1 leads to the decrease of methyl beta-D-glucopyranoside levels compared with control group.
References
1 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8. J Biol Chem. 2013 Mar 29;288(13):9092-101.
2 Transendothelial glucose transport is not restricted by extracellular hyperglycaemia. Vascul Pharmacol. 2016 Dec;87:219-229.
3 Stomatin-deficient cryohydrocytosis results from mutations in SLC2A1: a novel form of GLUT1 deficiency syndrome. Blood. 2011 Nov 10;118(19):5267-77.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.