Details of Protein

General Information of Protein (ID: PRT01101)
Name Sodium-dependent phosphate transport 4 (SLC17A3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Na(+)/PI cotransporter 4; Sodium/phosphate cotransporter 4; Solute carrier family 17 member 3; SLC17A3; NPT4
Gene Name SLC17A3 Gene ID
10786
UniProt ID
O00476
Family Sodium/anion cotransporter (SAC)
TC Number   TC: 2.A.1.14.28  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Anion:Cation Symporter (ACS) Family
TC: 2.A.1.14.28
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMN
ITMVAMVNSTSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQE
RSRLCSIALSGMLLGCFTAILIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVS
YPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWSICLGCFSHQWLVSTMVVYIP
TYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLLTKKFRLITVRKIATILGSLP
SSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSFLMGASRGFSS
IAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL
Function [Isoform 2]: voltage-driven, multispecific, organic anion transporter able to transport para-aminohippurate (PAH), estrone sulfate, estradiol-17-beta-glucuronide, bumetanide, and ochratoxin A. Isoform 2 functions as urate efflux transporter on the apical side of renal proximal tubule and is likely to act as an exit path for organic anionic drugs as well as urate in vivo. May be involved in actively transporting phosphate into cells via Na(+) cotransport.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            4-Aminohippuric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change 4-Aminohippuric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of 4-aminohippuric acid levels compared with control group.
            Bumetanide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change Bumetanide concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of bumetanide levels compared with control group.
      Lipids and lipid-like molecules
            Estradiol-17beta-glucuronide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change Estradiol-17beta-glucuronide concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of estradiol-17beta-glucuronide levels compared with control group.
            Estrone sulfate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change Estrone sulfate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of estrone sulfate levels compared with control group.
      Organoheterocyclic compounds
            Uric acid Click to Show/Hide the Full List of Regulating Pair(s):   3 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (F304S) of SLC17A3
                      Induced Change Uric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (F304S) of SLC17A3 leads to the decrease of uric acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (N68H) of SLC17A3
                      Induced Change Uric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N68H) of SLC17A3 leads to the decrease of uric acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change Uric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of uric acid levels compared with control group.
      Phenylpropanoids and polyketides
            Ochratoxin A Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC17A3
                      Induced Change Ochratoxin A concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC17A3 leads to the increase of ochratoxin A levels compared with control group.
References
1 Human sodium phosphate transporter 4 (hNPT4/SLC17A3) as a common renal secretory pathway for drugs and urate. J Biol Chem. 2010 Nov 5;285(45):35123-32.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.