Details of Protein
| General Information of Protein (ID: PRT01080) | |||||
|---|---|---|---|---|---|
| Name | Group 3 secretory phospholipase A2 (PLA2G3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Group III secretory phospholipase A2; GIII sPLA2; sPLA2-III; Phosphatidylcholine 2-acylhydrolase 3; Pla2g3
|
||||
| Gene Name | Pla2g3 | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| EC Number | EC: 3.1.1.4 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGVLGVLLGVLAFLEGSHTRHWDSTSCHLVQPIPGNPLGSLSFLGKDAQGLALFQAFWDT
HHRLQVCIRQDESELITAFRALCAHEPLQHSFIQTPGPALQRALATLQSQWEACQRSQDS PTGAREKRAIEQSGAPDREHRRRRRGWTIPGTLWCGVGNSAENASELGVFHGPDLCCREH DQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSISDIMGVAFFNVLEIPC FVLKEQEACVAWNWWGGCRAYGSTPLAHLRPRTYYNASWKAEATSYTPSPQSPAPSKHPQ KRGPQQTQARRHSTTTTTPFQTPAISSRPDMIPRGQPGVPHLGFQDGPKHQSAHRVCRSL RHLDQCEHQIKPQETKFHLLNSAQMPLFHCDCTRRLARFLRLHSPPAGTDKVWDLLGTTC FKLAPQLDCAEGKGCSRDHRAIKVSARHLQRLHKSRLHFRDKGTGGALAQPVEPPGSTMS FYSQCLQVTQAIWRRRGQKKFWSS |
||||
| Function | Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids without apparent head group selectivity. Contributes to phospholipid remodeling of low-density lipoprotein (LDL) and high-density lipoprotein (HDL) particles. Hydrolyzes LDL phospholipids releasing unsaturated fatty acids that regulate macrophage differentiation toward foam cells. May act in an autocrine and paracrine manner. Secreted by immature mast cells, acts on nearby fibroblasts upstream to PTDGS to synthesize prostaglandin D2 (PGD2), which in turn promotes mast cell maturation and degranulation via PTGDR. Secreted by epididymal epithelium, acts on immature sperm cells within the duct, modulating the degree of unsaturation of the fatty acyl components of phosphatidylcholines required for acrosome assembly and sperm cell motility. Facilitates the replacement of fatty acyl chains in phosphatidylcholines in sperm membranes from omega-6 and omega-9 to omega-3 polyunsaturated fatty acids (PUFAs). Coupled to lipoxygenase pathway, may process omega-6 PUFAs to generate oxygenated lipid mediators in the male reproductive tract. At pericentrosomal preciliary compartment, negatively regulates ciliogenesis likely by regulating endocytotic recycling of ciliary membrane protein. Coupled to cyclooxygenase pathway provides arachidonate to generate prostaglandin E2 (PGE2), a potent immunomodulatory lipid in inflammation and tumorigenesis. At colonic epithelial barrier, preferentially hydrolyzes phospholipids having arachidonate and docosahexaenoate at sn-2 position, contributing to the generation of oxygenated metabolites involved in colonic stem cell homeostasis. Releases C16:0 and C18:0 lysophosphatidylcholine subclasses from neuron plasma membranes and promotes neurite outgrowth and neuron survival. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| (10E,12Z)-9-HODE | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | (10E,12Z)-9-HODE concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of (10E,12Z)-9-HODE levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | (10E,12Z)-9-HODE concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of (10E,12Z)-9-HODE levels compared with control group. | |||||
| 12-HETE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | 12-HETE concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of 12-HETE levels compared with control group. | |||||
| 12S-HHT | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | 12S-HHT concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of 12S-HHT levels compared with control group. | |||||
| 13-HODE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | 13-HODE concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of 13-HODE levels compared with control group. | |||||
| 15-HETE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | 15-HETE concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of 15-HETE levels compared with control group. | |||||
| 8(S)-HETE | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | 8(S)-HETE concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of 8(S)-HETE levels compared with control group. | |||||
| Arachidonic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Arachidonic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of arachidonic acid levels compared with control group. | |||||
| Docosahexaenoic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Docosahexaenoic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of docosahexaenoic acid levels compared with control group. | |||||
| Eicosapentaenoic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Eicosapentaenoic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of eicosapentaenoic acid levels compared with control group. | |||||
| Linoleic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Linoleic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of linoleic acid levels compared with control group. | |||||
| Lipoxin A4 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Lipoxin A4 concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of lipoxin A4 levels compared with control group. | |||||
| LysoPA(16:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | LysoPA(16:0/0:0) concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of lysoPA(16:0/0:0) levels compared with control group. | |||||
| LysoPC(0:0/16:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | LysoPC(0:0/16:0) concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of lysoPC(0:0/16:0) levels compared with control group. | |||||
| LysoPC(0:0/18:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | LysoPC(0:0/18:0) concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of lysoPC(0:0/18:0) levels compared with control group. | |||||
| LysoPI(16:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | LysoPI(16:0/0:0) concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of lysoPI(16:0/0:0) levels compared with control group. | |||||
| LysoPI(18:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | LysoPI(18:0/0:0) concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the decrease of lysoPI(18:0/0:0) levels compared with control group. | |||||
| Oleic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Oleic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of oleic acid levels compared with control group. | |||||
| Prostaglandin E2 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Prostaglandin E2 concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of prostaglandin E2 levels compared with control group. | |||||
| Resolvin D1 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Pla2g3 | |||||
| Induced Change | Resolvin D1 concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colorectal cancer [ICD-11: 2B91] | |||||
| Details | It is reported that knockout of Pla2g3 leads to the increase of resolvin D1 levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

