Details of Protein

General Information of Protein (ID: PRT00881)
Name Alkaline ceramidase 1 (ACER1)
Synonyms   Click to Show/Hide Synonyms of This Protein
AlkCDase 1; Alkaline CDase 1; maCER1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3; Acer1; Asah3
Gene Name Acer1 Gene ID
171168
UniProt ID
Q8R4X1
Family Hydrolases (EC 3)
EC Number   EC: 3.5.1.23  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Linear amide hydrolase
EC: 3.5.1.23
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY
AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK
FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH
LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY
EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC
Function Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH. Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation. Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide. May also hydrolyze dihydroceramides to produce dihydrosphingosine. ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipid-related molecules
            Alpha-hydroxy-ceramides Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Alpha-hydroxy-ceramides concentration: increase (FC = 3.70)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of alpha-hydroxy-ceramides levels compared with control group.
      Lipids and lipid-like molecules
            Ceramide(d18:1/16:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Ceramide(d18:1/16:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of ceramide(d18:1/16:0) levels compared with control group.
            Ceramide(d18:1/23:0) Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Ceramide(d18:1/23:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the decrease of ceramide(d18:1/23:0) levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Ceramide(d18:1/23:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of ceramide(d18:1/23:0) levels compared with control group.
            Ceramide(d20:1/18:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Ceramide(d20:1/18:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of ceramide(d20:1/18:0) levels compared with control group.
            Ceramide(t18:0/16:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Ceramide(t18:0/16:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of ceramide(t18:0/16:0) levels compared with control group.
      Organic nitrogen compounds
            Phytosphingosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Phytosphingosine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of phytosphingosine levels compared with control group.
            Sphinganine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Sphinganine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of sphinganine levels compared with control group.
            Sphingosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Acer1
                      Induced Change Sphingosine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Acer1 leads to the increase of sphingosine levels compared with control group.
References
1 Alkaline Ceramidase 1 Protects Mice from Premature Hair Loss by Maintaining the Homeostasis of Hair Follicle Stem Cells. Stem Cell Reports. 2017 Nov 14;9(5):1488-1500.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.