Details of Protein

General Information of Protein (ID: PRT00878)
Name Glucose-6-phosphatase 3 (G6PC3)
Synonyms   Click to Show/Hide Synonyms of This Protein
G-6-Pase 3; G6Pase 3; Ubiquitous glucose-6-phosphatase catalytic subunit-related protein; G6pc3; Ugrp
Gene Name G6pc3 Gene ID
68401
UniProt ID
Q6NSQ9
Family Hydrolases (EC 3)
EC Number   EC: 3.1.3.9  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.9
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPAAYYASRRLGISVLWI
TFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSCETGPGSPSGHCMITGA
ALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVFLLAHFPHQVLGGLIVGA
ALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGLDLSWSINLASKWCERPEW
VHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIACFVLAMGLLVFLEWL
GYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEAPPIRSS
Function Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. May form with the glucose-6-phosphate transporter (SLC37A4/G6PT) a ubiquitously expressed complex responsible for glucose production through glycogenolysis and gluconeogenesis. Probably required for normal neutrophil function.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            1,5-Anhydroglucitol-6-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of G6pc3
                      Induced Change 1,5-Anhydroglucitol-6-phosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Neutropenia [ICD-11: 4B00]
                      Details It is reported that knockout of G6pc3 leads to the increase of 1,5-anhydroglucitol-6-phosphate levels compared with control group.
            Fructose 1,6-bisphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of G6pc3
                      Induced Change Fructose 1,6-bisphosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Neutropenia [ICD-11: 4B00]
                      Details It is reported that knockout of G6pc3 leads to the decrease of fructose 1,6-bisphosphate levels compared with control group.
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of G6pc3
                      Induced Change Glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Neutropenia [ICD-11: 4B00]
                      Details It is reported that knockout of G6pc3 leads to the decrease of glucose levels compared with control group.
            Glyceraldehyde 3-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of G6pc3
                      Induced Change Glyceraldehyde 3-phosphate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Neutropenia [ICD-11: 4B00]
                      Details It is reported that knockout of G6pc3 leads to the decrease of glyceraldehyde 3-phosphate levels compared with control group.
      Phenylpropanoids and polyketides
            6-O-p-Coumaroyl-D-glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of G6pc3
                      Induced Change 6-O-p-Coumaroyl-D-glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Neutropenia [ICD-11: 4B00]
                      Details It is reported that knockout of G6pc3 leads to the decrease of 6-o-p-Coumaroyl-D-glucose levels compared with control group.
References
1 Failure to eliminate a phosphorylated glucose analog leads to neutropenia in patients with G6PT and G6PC3 deficiency. Proc Natl Acad Sci U S A. 2019 Jan 22;116(4):1241-1250.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.