Details of Protein

General Information of Protein (ID: PRT00780)
Name Neutral amino acid transporter A (SLC1A4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Alanine/serine/cysteine/threonine transporter 1; ASCT-1; SATT; Solute carrier family 1 member 4; SLC1A4; ASCT1; SATT
Gene Name SLC1A4 Gene ID
6509
UniProt ID
P43007
Family Dicarboxylate/amino acid:cation symporter (DAACS)
TC Number   TC: 2.A.23.3.1  (Click to Show/Hide the Complete TC Tree)
The Dicarboxylate/Amino Acid:Cation (Na+ or H+) Symporter (DAACS) Family
.
TC: 2.A.23.3.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGA
ALRGLSLSRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAY
FGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFP
SNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEGMNILGLVLFALVLGVALKKL
GSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSKIVEMKDIIVLVTSLGKYIFA
SILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLPSMMKCIEENN
GVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA
AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQK
ATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
Function Transporter for alanine, serine, cysteine, and threonine. Exhibits sodium dependence.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Alanine Click to Show/Hide the Full List of Regulating Pair(s):   3 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC1A4
                      Induced Change Alanine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC1A4 leads to the increase of alanine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Alanine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of alanine levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Alanine concentration: increase (FC = 1.40 - 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the increase of alanine levels compared with control group.
            Cysteine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC1A4
                      Induced Change Cysteine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC1A4 leads to the increase of cysteine levels compared with control group.
            D-Serine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change D-Serine concentration: decrease (FC = 0.10-0.20)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of D-Serine levels compared with control group.
            Glutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Glutamic acid concentration: decrease (FC = 0.93)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of glutamic acid levels compared with control group.
            Glycine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Glycine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of glycine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Glycine concentration: increase (FC = 1.40 - 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the increase of glycine levels compared with control group.
            Serine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC1A4
                      Induced Change Serine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC1A4 leads to the increase of serine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Serine concentration: decrease (FC = 0.10-0.20)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of serine levels compared with control group.
            Succinic acid Click to Show/Hide the Full List of Regulating Pair(s): 13 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (N144A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N144A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (N484A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N484A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (P255T) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (P255T) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (P255T+T485P) of SLC1A4
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (P255T+T485P) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S143A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (S143A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (6) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S483A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (S483A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (7) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T145A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 26)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T145A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (8) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T253S) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T253S) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (9) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T485A) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T485A) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (10) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T485M) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T485M) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (11) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T485P) of SLC1A4
                      Induced Change Succinic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T485P) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (12) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T485V) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 0.40-0.80)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T485V) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (13) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (T527N) of SLC1A4
                      Induced Change Succinic acid concentration: decrease (FC = 8)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T527N) of SLC1A4 leads to the decrease of succinic acid levels compared with control group.
            Threonine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Threonine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the decrease of threonine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of SLC1A4
                      Induced Change Threonine concentration: increase (FC = 1.40 - 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of SLC1A4 leads to the increase of threonine levels compared with control group.
References
1 Cloning and expression of a novel Na(+)-dependent neutral amino acid transporter structurally related to mammalian Na+/glutamate cotransporters. J Biol Chem. 1993 Jul 25;268(21):15351-5.
2 ASCT1 (Slc1a4) transporter is a physiologic regulator of brain d-serine and neurodevelopment. Proc Natl Acad Sci U S A. 2018 Sep 18;115(38):9628-9633.
3 Determinants of substrate and cation transport in the human Na+/dicarboxylate cotransporter NaDC3. J Biol Chem. 2014 Jun 13;289(24):16998-7008.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.