Details of Protein

General Information of Protein (ID: PRT00683)
Name P2Y purinoceptor 14 (P2RY14)
Synonyms   Click to Show/Hide Synonyms of This Protein
P2Y14; G-protein coupled receptor 105; UDP-glucose receptor; P2RY14; GPR105; KIAA0001
Gene Name P2RY14 Gene ID
9934
UniProt ID
Q15391
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Structure
2B6V
Function Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Nucleosides, nucleotides, and analogues
            Cytidine-5'-diphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Cytidine-5'-diphosphate addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that cytidine-5'-diphosphate addition causes the increase of P2RY14 protein activity compared with control group.
            Guanosine diphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Guanosine diphosphate addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that guanosine diphosphate addition causes the increase of P2RY14 protein activity compared with control group.
            UDP glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation UDP glucose addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that UDP glucose addition causes the increase of P2RY14 protein activity compared with control group.
            UDP-N-acetylglucosamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation UDP-N-acetylglucosamine addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that UDP-N-acetylglucosamine addition causes the increase of P2RY14 protein activity compared with control group.
            Uridine 5'-diphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Uridine 5'-diphosphate addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that uridine 5'-diphosphate addition causes the increase of P2RY14 protein activity compared with control group.
            Uridine diphosphategalactose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Uridine diphosphategalactose addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that uridine diphosphategalactose addition causes the increase of P2RY14 protein activity compared with control group.
      Organic acids and derivatives
            Uridine 5'-O-thiodiphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Uridine 5'-O-thiodiphosphate addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that uridine 5'-O-thiodiphosphate addition causes the increase of P2RY14 protein activity compared with control group.
      Organoheterocyclic compounds
            Uridine diphosphate glucuronic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Uridine diphosphate glucuronic acid addition (2 hours)
                      Induced Change P2RY14 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that uridine diphosphate glucuronic acid addition causes the increase of P2RY14 protein activity compared with control group.
References
1 Quantification of Gi-mediated inhibition of adenylyl cyclase activity reveals that UDP is a potent agonist of the human P2Y14 receptor. Mol Pharmacol. 2009 Dec;76(6):1341-8.
2 Gi-dependent cell signaling responses of the human P2Y14 receptor in model cell systems. J Pharmacol Exp Ther. 2009 Jul;330(1):162-8.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.