Details of Protein

General Information of Protein (ID: PRT00505)
Name Alpha-methylacyl-CoA racemase (AMACR)
Synonyms   Click to Show/Hide Synonyms of This Protein
2-methylacyl-CoA racemase; Amacr; Macr1
Gene Name Amacr Gene ID
17117
UniProt ID
O09174
Family Isomerases (EC 5)
EC Number   EC: 5.1.99.4  (Click to Show/Hide the Complete EC Tree)
Isomerase
Racemase/epimerase
Racemase/epimerase
EC: 5.1.99.4
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVLRGVRVVELAGLAPGPFCGMVLADFGAEVVRVNRLGSTGENFLARGKRSLALDLKRSQ
GVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFSKVAG
HDINYLALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGIVLALFERTRSGRGQVID
SSMVEGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTYKTADGEFMAVGAIEPQFY
ALLLKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFE
EALHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAKRDPSVGEHTVEVLREYGFSQ
EEILQLHSDRIVESDKLKANL
Function Catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters. Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Homogeneous metal compounds
            Potassium Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change Potassium concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of potassium levels compared with control group.
            Sodium Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change Sodium concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of sodium levels compared with control group.
      Lipids and lipid-like molecules
            Cholesterol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1], [2]
                      Introduced Variation Knockout of Amacr
                      Induced Change Cholesterol concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that knockout of Amacr leads to the increase of cholesterol levels compared with control group.
            TG(18:0/18:0/18:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change TG(18:0/18:0/18:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of TG(18:0/18:0/18:0) levels compared with control group.
      Organic acids and derivatives
            Creatinine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change Creatinine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of creatinine levels compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change Glucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of glucose levels compared with control group.
      Organoheterocyclic compounds
            Uric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Amacr
                      Induced Change Uric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Amacr leads to the increase of uric acid levels compared with control group.
References
1 Phytol is lethal for Amacr-deficient mice. Biochim Biophys Acta. 2015 Oct;1851(10):1394-405.
2 Role of -glucosidase 2 in aberrant glycosphingolipid metabolism: model of glucocerebrosidase deficiency in zebrafish. J Lipid Res. 2019 Nov;60(11):1851-1867.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.