Details of Protein

General Information of Protein (ID: PRT01219)
Name Solute carrier family 22 member 8 (SLC22A8)
Synonyms   Click to Show/Hide Synonyms of This Protein
Organic anion transporter 3; hOAT3; SLC22A8; OAT3
Gene Name SLC22A8 Gene ID
9376
UniProt ID
Q8TCC7
Family Organic ion transporter (OIT)
TC Number   TC: 2.A.1.19.34  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Organic Cation Transporter (OCT) Family (The SLC22A family including OCT1-3, OCTN1-3 and OAT1-5 of H. sapiens)
TC: 2.A.1.19.34
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Function Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            Estrone sulfate Click to Show/Hide the Full List of Regulating Pair(s):   9 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Bumetanide) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Cimetidine) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Furosemide) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Indomethacin) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Methotrexate) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (6) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Probenecid) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (7) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Steviol) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (8) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Unlabeled Estrone sulfate; Hoat3(ES)) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
               Regulating Pair (9) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Unlabeled Para-aminohippurate (PAH)) of SLC22A8
                      Induced Change Estrone sulfate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC22A8 leads to the decrease of estrone sulfate levels compared with control group.
      Phenylpropanoids and polyketides
            Tetracycline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of SLC22A8
                      Induced Change Tetracycline concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC22A8 leads to the increase of tetracycline levels compared with control group.
References
1 Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). J Pharmacol Exp Ther. 2005 May;313(2):621-8.
2 Human organic anion transporters mediate the transport of tetracycline. Jpn J Pharmacol. 2002 Jan;88(1):69-76.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.