Details of Protein

General Information of Protein (ID: PRT01136)
Name Carnitine O-palmitoyltransferase 1 (CPT1)
Synonyms   Click to Show/Hide Synonyms of This Protein
CPT1-B; CPT IC; Carnitine O-palmitoyltransferase I, brain isoform; CPTI-B; Carnitine palmitoyltransferase 1C; Cpt1c
Gene Name Cpt1c Gene ID
78070
UniProt ID
Q8BGD5
Family Transferases (EC 2)
EC Number   EC: 2.3.1.21  (Click to Show/Hide the Complete EC Tree)
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.21
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAEAHQASSLLSSLSSDGAEVELSSPVWQEIYLCALRSWKRHLWRVWNDFLAGVVPATPL
SWLFLFSTIQLACLLQLDPSLGLMEKIKELLPDWGGQHHQLQGFLSAAVFASCLWGALIF
TLHVALRLLLSHHGWLLEPHGAMSSPTKTWLALVRIFSGRHPRLFSFQRALPRQPVPSAQ
ETVRKYLESVRPVLGDDAFDRATALANDFLRLHAPRLQLYLQLKSWCTSNYVSDWWEEFV
YLRSRGSLINSTYYMMDFLYVTPTPLQAARAGNAVHTLLLYRHLLNRQEISPTLLMGMRP
LCSAQYERMFNTTRIPGVEKDHLRHLQDSRHVAVFHRGRFFRVGTHSPNGLLSPRALEQQ
FQDILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAATALEAVEGAAFFVSLDSEP
AGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPVSGHL
WEFTLATECFQLGYATDGHCKGHPDPTLPQPQRLQWDLPEQIQPSISLALRGAKTLSGNI
DCHVFPFSHFGKSFIKCCHVSSDSFIQLVLQLAHFRDRGQFCLTYESAMTRLFLEGRTET
VRSCTREACQFVRAMDNKETDQHCLALFRVAVDKHQALLKAAMSGQGIDRHLFALYIMSR
LLHMQSPFLTQVQSQQWLLSTSQVPVQQTHLIDVHNYPDYVSSGGGFGPAHDHGYGISYI
FMGENAITFHISSKKSSTETDSHRLGQHIENALLDVASLFRVGQHFKRQFRGENSDYRYN
FLSCKTVDPNTPTSSTNL
Function May play a role in lipid metabolic process.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            Eicosapentaenoic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Eicosapentaenoic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of eicosapentaenoic acid levels compared with control group.
            Hydroxypropionylcarnitine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Hydroxypropionylcarnitine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of hydroxypropionylcarnitine levels compared with control group.
            MG(0:0/18:1(9Z)/0:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change MG(0:0/18:1(9Z)/0:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of MG(0:0/18:1(9Z)/0:0) levels compared with control group.
      Organic acids and derivatives
            3-Dehydrocarnitine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change 3-Dehydrocarnitine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the increase of 3-dehydrocarnitine levels compared with control group.
            Betaine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Betaine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of betaine levels compared with control group.
            Cysteineglutathione disulfide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Cysteineglutathione disulfide concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the increase of cysteineglutathione disulfide levels compared with control group.
            Oxidized glutathione Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout (Gene: exons 1 and 2 of the cpt1c) of Cpt1c
                      Induced Change Oxidized glutathione concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the increase of oxidized glutathione levels compared with control group.
            Palmitoylethanolamide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Palmitoylethanolamide concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of palmitoylethanolamide levels compared with control group.
            Pyroglutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Pyroglutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of pyroglutamic acid levels compared with control group.
      Organic nitrogen compounds
            Carnitine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Carnitine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the decrease of carnitine levels compared with control group.
            Ethanolamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Cpt1c
                      Induced Change Ethanolamine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Cpt1c leads to the increase of ethanolamine levels compared with control group.
References
1 Metabolomic profiling reveals a role for CPT1c in neuronal oxidative metabolism. BMC Biochem. 2012 Oct 25;13:23.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.