Details of Protein

General Information of Protein (ID: PRT01096)
Name Organic anion transporter F (SLCO1C1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Organic anion transporter F; OATP-F; Organic anion transporter polypeptide-related protein 5; OAT-RP-5; OATPRP5; Organic anion-transporting polypeptide 14; OATP-14; Solute carrier family 21 member 14; Thyroxine transporter; SLCO1C1; OATP14; OATP1C1; OATPF; SLC21A14
Gene Name SLCO1C1 Gene ID
53919
UniProt ID
Q9NYB5
Family Organo anion transporter (OAT)
TC Number   TC: 2.A.60.1.15  (Click to Show/Hide the Complete TC Tree)
The Organo Anion Transporter (OAT) Family
.
TC: 2.A.60.1.15
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAV
LFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL
Function Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones thyroxine (T4) and rT3. Other potential substrates, such as triiodothyronine (T3), 17-beta-glucuronosyl estradiol, estrone-3-sulfate and sulfobromophthalein (BSP) are transported with much lower efficiency. May play a significant role in regulating T4 flux into and out of the brain.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            Sulfobromophthalein Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLCO1C1
                      Induced Change Sulfobromophthalein concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLCO1C1 leads to the increase of sulfobromophthalein levels compared with control group.
      Lipids and lipid-like molecules
            17-Beta-Estradiol glucuronide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLCO1C1
                      Induced Change 17-Beta-Estradiol glucuronide concentration: increase (FC = 2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLCO1C1 leads to the increase of 17-beta-Estradiol glucuronide levels compared with control group.
            Estrone sulfate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLCO1C1
                      Induced Change Estrone sulfate concentration: increase (FC = 2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLCO1C1 leads to the increase of estrone sulfate levels compared with control group.
      Organic acids and derivatives
            Liothyronine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLCO1C1
                      Induced Change Liothyronine concentration: increase (FC = 14)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLCO1C1 leads to the increase of liothyronine levels compared with control group.
            Thyroxine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLCO1C1
                      Induced Change Thyroxine concentration: increase (FC = 11)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLCO1C1 leads to the increase of thyroxine levels compared with control group.
References
1 Identification of a novel human organic anion transporting polypeptide as a high affinity thyroxine transporter. Mol Endocrinol. 2002 Oct;16(10):2283-96.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.