Details of Protein

General Information of Protein (ID: PRT00946)
Name Glucose transporter type 3 (GLUT-3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 3; GLUT-3; SLC2A3; GLUT3
Gene Name SLC2A3 Gene ID
6515
UniProt ID
P11169
Family Sugar transporter (ST)
TC Number   TC: 2.A.1.1.91  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Sugar Porter (SP) Family
TC: 2.A.1.1.91
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEML
ILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGS
EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQ
EMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYN
GMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGV
MEMNSIEPAKETTTNV
Structure
4ZW9 ; 4ZWB ; 4ZWC ; 5C65 ; 7CRZ
Function Facilitative glucose transporter that can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            2-Deoxyglucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1], [2]
                      Introduced Variation Overexpression of SLC2A3
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that overexpression of SLC2A3 leads to the increase of 2-deoxyglucose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (p.277-279 HVA>QLS) of SLC2A3
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (p.277-279 HVA>QLS) of SLC2A3 leads to the increase of 2-deoxyglucose levels compared with control group.
      Organic oxygen compounds
            Fructose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (p.277-279 HVA>QLS) of SLC2A3
                      Induced Change Fructose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (p.277-279 HVA>QLS) of SLC2A3 leads to the decrease of fructose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Knockdown (siRNA) of SLC2A3
                      Induced Change Fructose concentration: decrease (FC = 0.72)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Insulin-resistance syndromes [ICD-11: 5A44]
                      Details It is reported that knockdown of SLC2A3 leads to the decrease of fructose levels compared with control group.
References
1 QLS motif in transmembrane helix VII of the glucose transporter family interacts with the C-1 position of D-glucose and is involved in substrate selection at the exofacial binding site. Biochemistry. 1998 Feb 3;37(5):1322-6.
2 Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1. Mol Genet Metab. Sep-Oct 2001;74(1-2):186-99.
3 Transendothelial glucose transport is not restricted by extracellular hyperglycaemia. Vascul Pharmacol. 2016 Dec;87:219-229.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.