Details of Protein

General Information of Protein (ID: PRT00718)
Name Solute carrier family 23 member 1 (SLC23A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Na(+)/L-ascorbic acid transporter 1; Sodium-dependent vitamin C transporter 1; Yolk sac permease-like molecule 3; Slc23a1; Svct1; Yspl3
Gene Name Slc23a1 Gene ID
20522
UniProt ID
Q9Z2J0
Family Nucleobase/ascorbate transporter (NAT)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKTPEDPGSPKQHEVVDSAGTSTRDRQAPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYL
TCFSGTIAVPFLLAEALCVGRDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFA
FLVPAKSILALERWKCPSEEEIYGNWSMPLNTSHIWHPRIREVQGAIMVSSMVEVVIGLM
GLPGALLSYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIVLFSQYLRNLTF
LLPVYRWGKGLTLFRVQIFKMFPIVLAIMTVWLLCYVLTLTDVLPADPTVYGFQARTDAR
GDIMAISPWIRIPYPCQWGLPTVTVAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPV
HAINRGIFTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAGIMLILGAI
GKFTALFASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPN
YLDSNPGAINTGIPEVDQILTVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHA
NSETSASLKSYDFPFGMGMVKRTTFFRYIPICPVFRGFSKKTQNQPPVLEDTPDNIETGS
VCTKV
Function Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Creatinine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Slc23a1
                      Induced Change Creatinine concentration: increase (FC = 1.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Slc23a1 leads to the increase of creatinine levels compared with control group.
      Organic oxygen compounds
            Glucuronic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Slc23a1
                      Induced Change Glucuronic acid concentration: increase (FC = 2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Slc23a1 leads to the increase of glucuronic acid levels compared with control group.
      Organo heterocyclic compounds
            6-Bromo-6-deoxy-L-ascorbate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Slc23a1
                      Induced Change 6-Bromo-6-deoxy-L-ascorbate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Slc23a1 leads to the decrease of 6-bromo-6-deoxy-L-ascorbate levels compared with control group.
      Organoheterocyclic compounds
            Ascorbic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Slc23a1
                      Induced Change Ascorbic acid concentration: decrease (FC = 3-18)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Slc23a1 leads to the decrease of ascorbic acid levels compared with control group.
References
1 Vitamin C transporter Slc23a1 links renal reabsorption, vitamin C tissue accumulation, and perinatal survival in mice. J Clin Invest. 2010 Apr;120(4):1069-83.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.