Details of Protein
| General Information of Protein (ID: PRT00631) | |||||
|---|---|---|---|---|---|
| Name | Glucagon receptor (GCGR) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
GL-R; GCGR
|
||||
| Gene Name | GCGR | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR secretin (GPCR-2) | ||||
| TC Number | TC: 9.A.14.4.13 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF |
||||
| Structure | |||||
| Function | G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| Cyclic AMP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Cyclic AMP concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the decrease of cyclic AMP levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Alanine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Alanine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of alanine levels compared with control group. | |||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Arginine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of arginine levels compared with control group. | |||||
| D-Lysine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | D-Lysine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of D-Lysine levels compared with control group. | |||||
| Glutamic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Glutamic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of glutamic acid levels compared with control group. | |||||
| Glycine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Glycine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of glycine levels compared with control group. | |||||
| Histidine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Histidine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of histidine levels compared with control group. | |||||
| Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Methionine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of methionine levels compared with control group. | |||||
| Proline | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Proline concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of proline levels compared with control group. | |||||
| Serine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Serine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of serine levels compared with control group. | |||||
| Threonine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Threonine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of threonine levels compared with control group. | |||||
| Tyrosine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Tyrosine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of tyrosine levels compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Glucose concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the increase of glucose levels compared with control group. | |||||
| Glycogen | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Antagonist (GRA1) of GCGR | |||||
| Induced Change | Glycogen concentration: decrease (FC = 0.80) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that antagonist of GCGR leads to the decrease of glycogen levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Anti-diabetic efficacy and impact on amino acid metabolism of GRA1, a novel small-molecule glucagon receptor antagonist. PLoS One. 2012;7(11):e49572. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

