Details of Protein

General Information of Protein (ID: PRT00280)
Name Succinate-hydroxymethylglutarate CoA-transferase (SUGCT)
Synonyms   Click to Show/Hide Synonyms of This Protein
SuccinylCoA:glutarate-CoA transferase; Sugct
Gene Name Sugct Gene ID
192136
UniProt ID
Q7TNE1
Family Transferases (EC 2)
EC Number   EC: 2.8.3.13  (Click to Show/Hide the Complete EC Tree)
Transferase
Sulfotransferase
CoA-transferase
EC: 2.8.3.13
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLWMLARAVAFRRPGRGLAGGRGLWTGRPQSDCDSMKPLEGVRILDLTRVLAGPFATMNL
GDLGAEVIKVERPGAGDDTRSWGPPFVNTESTYFLSVNRNKKSIAVNIKDPRGVRIVKEL
AAICDVFVENYVPGKLSEMGLGYEDIDKIAPHIIYCSITGYGQTGPMSHRAGYDAIASAM
SGLMHITGPEDGDPVRPGVAMTDLATGLFAYGAIMAGLLQRYRTGKGLFIDCNLLSSQVA
CLTQVAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKILNLPE
LIDDCKYRTNHLRVQNRKELVKILSARFAEEVTAKWLCLFEGSGIPYGPINSLKDVFSEA
QVLHNGLVMEMNHPTVGKISVPGPAVRYSKFKMSEAKPPPLLGQHTRHILKEVLRYDEGA
IEKLLCSGVIEQHETK
Function Catalyzes the succinyl-CoA-dependent conversion of glutarate to glutaryl-CoA. Can use different dicarboxylic acids as CoA acceptors, the preferred ones are glutarate, succinate, adipate, and 3-hydroxymethylglutarate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            FAD Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change FAD concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of FAD levels compared with control group.
      Lipid-related molecules
            Linoelaidylcarnitine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Linoelaidylcarnitine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of linoelaidylcarnitine levels compared with control group.
      Lipids and lipid-like molecules
            Adipic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Adipic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of adipic acid levels compared with control group.
            cis-5-Tetradecenoylcarnitine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change cis-5-Tetradecenoylcarnitine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the decrease of cis-5-Tetradecenoylcarnitine levels compared with control group.
            Linoleic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Linoleic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of linoleic acid levels compared with control group.
            Octadec-9-enoic Acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Octadec-9-enoic Acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of octadec-9-enoic Acid levels compared with control group.
      Organic acids
            Egtazic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Egtazic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of egtazic acid levels compared with control group.
      Organic acids and derivatives
            Glutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Glutaric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of glutaric acid levels compared with control group.
            Tyrosyl-Tyrosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Tyrosyl-Tyrosine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of tyrosyl-tyrosine levels compared with control group.
      Organic oxygen compounds
            Octanal Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Octanal concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of octanal levels compared with control group.
      Organoheterocyclic compounds
            5-Hydroxy-L-tryptophan Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change 5-Hydroxy-L-tryptophan concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the decrease of 5-hydroxy-L-tryptophan levels compared with control group.
            Riboflavin cyclic-4',5'-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Sugct
                      Induced Change Riboflavin cyclic-4',5'-phosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Diabetes mellitus [ICD-11: 5A14]
                      Details It is reported that knockout of Sugct leads to the increase of riboflavin cyclic-4',5'-phosphate levels compared with control group.
References
1 Knockout of the non-essential gene SUGCT creates diet-linked, age-related microbiome disbalance with a diabetes-like metabolic syndrome phenotype. Cell Mol Life Sci. 2020 Sep;77(17):3423-3439.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.