Details of Protein

General Information of Protein (ID: PRT01582)
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 (PFKFB4)
Synonyms   Click to Show/Hide Synonyms of This Protein
6PF-2-K/Fru-2,6-P2ase 4; PFK/FBPase 4; 6PF-2-K/Fru-2,6-P2ase testis-type isozyme; PFKFB4
Gene Name PFKFB4 Gene ID
5210
UniProt ID
Q16877
Family Transferases (EC 2)
EC Number   EC: 2.7.1.105  (Click to Show/Hide the Complete EC Tree)
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.105
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ
Function Synthesis and degradation of fructose 2,6-bisphosphate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of PFKFB4
                      Induced Change ATP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that knockdown of PFKFB4 leads to the decrease of ATP levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of PFKFB4
                      Induced Change ATP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that overexpression of PFKFB4 leads to the increase of ATP levels compared with control group.
            NADP Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of PFKFB4
                      Induced Change NADP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that knockdown of PFKFB4 leads to the increase of NADP levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of PFKFB4
                      Induced Change NADP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that overexpression of PFKFB4 leads to the decrease of NADP levels compared with control group.
      Organic oxygen compounds
            D-Fructose 2,6-bisphosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of PFKFB4
                      Induced Change D-Fructose 2,6-bisphosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that overexpression of PFKFB4 leads to the increase of D-fructose 2,6-bisphosphate levels compared with control group.
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2], [1]
                      Introduced Variation Knockdown (shRNA) of PFKFB4
                      Induced Change Glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that knockdown of PFKFB4 leads to the decrease of glucose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of PFKFB4
                      Induced Change Glucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60] ...
                      Details It is reported that overexpression of PFKFB4 leads to the increase of glucose levels compared with control group.
References
1 Fructose-2,6-bisphosphate synthesis by 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 (PFKFB4) is required for the glycolytic response to hypoxia and tumor growth. Oncotarget. 2014 Aug 30;5(16):6670-86.
2 Snail reprograms glucose metabolism by repressing phosphofructokinase PFKP allowing cancer cell survival under metabolic stress. Nat Commun. 2017 Feb 8;8:14374.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.