Details of Protein

General Information of Protein (ID: PRT01209)
Name G-protein coupled receptor 143 (GPR143)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ocular albinism type 1 protein; GPR143; OA1
Gene Name GPR143 Gene ID
4935
UniProt ID
P51810
Family GPCR OA (GPCR-OA)
TC Number   TC: 9.A.14.20.1  (Click to Show/Hide the Complete TC Tree)
The G-protein-coupled receptor (GPCR) Family
.
TC: 9.A.14.20.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP
ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA
MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS
VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA
VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP
AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG
GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Function Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Plays also a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            L-Dopa Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation L-Dopa addition (12 hours)
                      Induced Change GPR143 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Albinism [ICD-11: EC23]
                      Details It is reported that L-Dopa addition causes the increase of GPR143 protein activity compared with control group.
            Tyrosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Tyrosine decrease (12 hours)
                      Induced Change GPR143 protein expression levels: increase (FC = 5)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Albinism [ICD-11: EC23]
                      Details It is reported that tyrosine decrease causes the increase of GPR143 protein expression compared with control group.
References
1 L-DOPA is an endogenous ligand for OA1. PLoS Biol. 2008 Sep 30;6(9):e236.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.