Details of Protein
| General Information of Protein (ID: PRT01182) | |||||
|---|---|---|---|---|---|
| Name | Extracellular matrix receptor III (CD44) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
CDw44; Epican; Extracellular matrix receptor III; ECMR-III; GP90 lymphocyte homing/adhesion receptor; HUTCH-I; Heparan sulfate proteoglycan; Hermes antigen; Hyaluronate receptor; Phagocytic glycoprotein 1; PGP-1; Phagocytic glycoprotein I; PGP-I; CD antigen CD44; CD44; LHR; MDU2; MDU3; MIC4
|
||||
| Gene Name | CD44 | Gene ID | |||
| UniProt ID | |||||
| Family | Transmembrane protein (TMEM) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET PDQFMTADETRNLQNVDMKIGV |
||||
| Structure | |||||
| Function | Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment. Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection. Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases. Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| DL-O-Phosphoserine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of CD44 | |||||
| Induced Change | DL-O-Phosphoserine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that knockdown of CD44 leads to the increase of DL-O-Phosphoserine levels compared with control group. | |||||
| Hypotaurine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of CD44 | |||||
| Induced Change | Hypotaurine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that knockdown of CD44 leads to the increase of hypotaurine levels compared with control group. | |||||
| Taurine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of CD44 | |||||
| Induced Change | Taurine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that knockdown of CD44 leads to the increase of taurine levels compared with control group. | |||||
| Organic oxygen compounds | ||||||
| 3-Phosphoglyceric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of CD44 | |||||
| Induced Change | 3-Phosphoglyceric acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that knockdown of CD44 leads to the increase of 3-phosphoglyceric acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Gold-nanofve surface-enhanced Raman spectroscopy visualizes hypotaurine as a robust anti-oxidant consumed in cancer survival. Nat Commun. 2018 Apr 19;9(1):1561. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

