Details of Protein

General Information of Protein (ID: PRT01172)
Name Monoacylglycerol lipase ABHD6 (ABHD6)
Synonyms   Click to Show/Hide Synonyms of This Protein
2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 6; Abhd6
Gene Name Abhd6 Gene ID
66082
UniProt ID
Q8R2Y0
Family Hydrolases (EC 3)
EC Number   EC: 3.1.1.23  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.1.23
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
Function Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways. Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids. Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism. BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            MG(0:0/20:4(5Z,8Z,11Z,14Z)/0:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (WWL70) of Abhd6
                      Induced Change MG(0:0/20:4(5Z,8Z,11Z,14Z)/0:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of Abhd6 leads to the increase of MG(0:0/20:4(5Z,8Z,11Z,14Z)/0:0) levels compared with control group.
            PGD2 ethanolamide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (WWL70) of Abhd6
                      Induced Change PGD2 ethanolamide concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of Abhd6 leads to the decrease of PGD2 ethanolamide levels compared with control group.
            Prostaglandin E2 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (WWL70) of Abhd6
                      Induced Change Prostaglandin E2 concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of Abhd6 leads to the decrease of prostaglandin E2 levels compared with control group.
            Prostaglandin J2 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (WWL70) of Abhd6
                      Induced Change Prostaglandin J2 concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of Abhd6 leads to the decrease of prostaglandin J2 levels compared with control group.
References
1 Implication of the anti-inflammatory bioactive lipid prostaglandin D2-glycerol ester in the control of macrophage activation and inflammation by ABHD6. Proc Natl Acad Sci U S A. 2013 Oct 22;110(43):17558-63.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.