Details of Protein
General Information of Protein (ID: PRT00952) | |||||
---|---|---|---|---|---|
Name | Cation channel sperm-associated 4 (CATSPER4) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
CatSper4; CATSPER4
|
||||
Gene Name | CATSPER4 | Gene ID | |||
UniProt ID | |||||
Family | Voltage-gated ion channel (VIC) | ||||
TC Number | TC: 1.A.1.19.1 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRDNEKAWWQQWTSHTGLEGWGGTQEDRMGFGGAVAALRGRPSPLQSTIHESYGRPEEQV
LINRQEITNKADAWDMQEFITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQK HYELFSTIDDIVLTILLCEVLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPS INYTLRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLFGAFV PKHFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGIN LFVIVVTTNLEQMMKAGEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSGLLQEP LAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQESEVLN RRSSTSGSLETTSSKDIRQMSQQQDLLSALVSMEKVHDSSSQILLKKHKSSH |
||||
Function | Voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Lipids and lipid-like molecules | ||||||
6-Keto-prostaglandin F1a | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | 6-Keto-prostaglandin F1a addition (6 hours) | |||||
Induced Change | CATSPER4 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that 6-keto-prostaglandin F1a addition causes the increase of CATSPER4 protein activity compared with control group. | |||||
Pantoic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Pantoic acid addition (6 hours) | |||||
Induced Change | CATSPER4 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that pantoic acid addition causes the increase of CATSPER4 protein activity compared with control group. | |||||
Prostaglandin E1 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Prostaglandin E1 addition (6 hours) | |||||
Induced Change | CATSPER4 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that prostaglandin E1 addition causes the increase of CATSPER4 protein activity compared with control group. | |||||
Prostaglandin E2 | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Prostaglandin E2 addition (6 hours) | |||||
Induced Change | CATSPER4 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that prostaglandin E2 addition causes the increase of CATSPER4 protein activity compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Progesterone activates the principal Ca2+ channel of human sperm. Nature. 2011 Mar 17;471(7338):387-91. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.