Details of Protein

General Information of Protein (ID: PRT00945)
Name Glucose transporter type 3 (GLUT-3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 3; GLUT-3; Slc2a3; Glut3
Gene Name Slc2a3 Gene ID
20527
UniProt ID
P32037
Family Sugar transporter (ST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGTTKVTPSLVFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLT
ALWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEML
ILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQIFGLDFILGS
EELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATEILQRLWGTSDVVQEIQ
EMKDESVRMSQEKQVTVLELFRSPNYVQPLLISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLLKDDYE
AMSFVCIVAILIYVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGCCNWTSNFLVGMLF
PSAAAYLGAYVFIIFAAFLIFFLIFTFFKVPETKGRTFEDIARAFEGQAHSGKGPAGVEL
NSMQPVKETPGNA
Function Facilitative glucose transporter that can also mediate the uptake of various other monosaccharides across the cell membrane. Mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and probably also dehydroascorbate. Does not mediate fructose transport.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            Butyric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (GLUT3+/-) of Slc2a3
                      Induced Change Butyric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (GLUT3+/-) of Slc2a3 leads to the increase of butyric acid levels compared with control group.
            Cholesterol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (GLUT3+/-) of Slc2a3
                      Induced Change Cholesterol concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (GLUT3+/-) of Slc2a3 leads to the increase of cholesterol levels compared with control group.
            TG(8:0/8:0/8:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (GLUT3+/-) of Slc2a3
                      Induced Change TG(8:0/8:0/8:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (GLUT3+/-) of Slc2a3 leads to the increase of TG(8:0/8:0/8:0) levels compared with control group.
References
1 Glucose transporter isoform-3-null heterozygous mutation causes sexually dimorphic adiposity with insulin resistance. Am J Physiol Endocrinol Metab. 2008 Jun;294(6):E1144-51.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.