Details of Protein

General Information of Protein (ID: PRT00939)
Name Phosphoinositide lipid phosphatase (PLIP)
Synonyms   Click to Show/Hide Synonyms of This Protein
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; PTEN-like phosphatase; Phosphoinositide lipid phosphatase; Protein-tyrosine phosphatase mitochondrial 1; Ptpmt1; Plip
Gene Name Ptpmt1 Gene ID
66461
UniProt ID
Q66GT5
Family Hydrolases (EC 3)
EC Number   EC: 3.1.3.27  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.27
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAASAWLEAGLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPLKNMTRRLV
LDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALK
YQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLK
EFHKEITARAAKN
Structure
3RGO ; 3RGQ
Function Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells. May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Ptpmt1
                      Induced Change ATP concentration: decrease (FC= 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Ptpmt1 leads to the decrease of ATP levels compared with control group.
      Organic acids and derivatives
            3-Hydroxybutyric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockout of Ptpmt1
                      Induced Change 3-Hydroxybutyric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that knockout of Ptpmt1 leads to the decrease of 3-hydroxybutyric acid levels compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Ptpmt1
                      Induced Change Oxoglutaric acid concentration: decrease (FC= 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Ptpmt1 leads to the decrease of oxoglutaric acid levels compared with control group.
            Pyruvic acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Ptpmt1
                      Induced Change Pyruvic acid concentration: decrease (FC= 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Ptpmt1 leads to the decrease of pyruvic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Ptpmt1
                      Induced Change Pyruvic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Ptpmt1 leads to the increase of pyruvic acid levels compared with control group.
References
1 Mitochondrial oxidation of the carbohydrate fuel is required for neural precursor/stem cell function and postnatal cerebellar development. Sci Adv. 2018 Oct 10;4(10):eaat2681.
2 Acyl coenzyme A thioesterase Them5/Acot15 is involved in cardiolipin remodeling and fatty liver development. Mol Cell Biol. 2012 Jul;32(14):2685-97.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.