Details of Protein
| General Information of Protein (ID: PRT00939) | |||||
|---|---|---|---|---|---|
| Name | Phosphoinositide lipid phosphatase (PLIP) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; PTEN-like phosphatase; Phosphoinositide lipid phosphatase; Protein-tyrosine phosphatase mitochondrial 1; Ptpmt1; Plip
|
||||
| Gene Name | Ptpmt1 | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| EC Number | EC: 3.1.3.27 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAASAWLEAGLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPLKNMTRRLV
LDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALK YQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLK EFHKEITARAAKN |
||||
| Structure | |||||
| Function | Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells. May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| ATP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ptpmt1 | |||||
| Induced Change | ATP concentration: decrease (FC= 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ptpmt1 leads to the decrease of ATP levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| 3-Hydroxybutyric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Knockout of Ptpmt1 | |||||
| Induced Change | 3-Hydroxybutyric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
| Details | It is reported that knockout of Ptpmt1 leads to the decrease of 3-hydroxybutyric acid levels compared with control group. | |||||
| Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ptpmt1 | |||||
| Induced Change | Oxoglutaric acid concentration: decrease (FC= 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ptpmt1 leads to the decrease of oxoglutaric acid levels compared with control group. | |||||
| Pyruvic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ptpmt1 | |||||
| Induced Change | Pyruvic acid concentration: decrease (FC= 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ptpmt1 leads to the decrease of pyruvic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ptpmt1 | |||||
| Induced Change | Pyruvic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ptpmt1 leads to the increase of pyruvic acid levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

