Details of Protein
| General Information of Protein (ID: PRT00884) | |||||
|---|---|---|---|---|---|
| Name | ORM1-like protein 3 (ORMDL3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Ormdl3
|
||||
| Gene Name | Ormdl3 | Gene ID | |||
| UniProt ID | |||||
| Family | Transmembrane protein (TMEM) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QVHFILNTVSLMTVLIPKLPQLHGVRIFGINKY |
||||
| Function | Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| Ceramide(d18:0/18:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ormdl3 | |||||
| Induced Change | Ceramide(d18:0/18:0) concentration: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | White matter disorders [ICD-11: 8A45] | |||||
| Details | It is reported that knockout of Ormdl3 leads to the increase of ceramide(d18:0/18:0) levels compared with control group. | |||||
| Organic nitrogen compounds | ||||||
| Sphinganine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ormdl3 | |||||
| Induced Change | Sphinganine concentration: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | White matter disorders [ICD-11: 8A45] | |||||
| Details | It is reported that knockout of Ormdl3 leads to the increase of sphinganine levels compared with control group. | |||||
| Sphingosine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ormdl3 | |||||
| Induced Change | Sphingosine concentration: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | White matter disorders [ICD-11: 8A45] | |||||
| Details | It is reported that knockout of Ormdl3 leads to the increase of sphingosine levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The Ormdl genes regulate the sphingolipid synthesis pathway to ensure proper myelination and neurologic function in mice. Elife. 2019 Dec 27;8:e51067. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.