Details of Protein

General Information of Protein (ID: PRT00816)
Name Dopamine receptor-interacting 3 (DRIP3)
Synonyms   Click to Show/Hide Synonyms of This Protein
YrdC domain-containing protein, mitochondrial; Ischemia/reperfusion-inducible protein homolog; hIRIP; YRDC; DRIP3; IRIP
Gene Name YRDC Gene ID
79693
UniProt ID
Q86U90
Family RNA-binding protein (RBP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSPARRCRGMRAAVAASVGLSEGPAGSRSGRLFRPPSPAPAAPGARLLRLPGSGAVQAAS
PERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACAASCSAALRAVYRLKGRSEAKPLAV
CLGRVADVYRYCRVRVPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFM
QDLAQMFEGPLALTSANLSSQASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTV
VDLSVPGKFGIIRPGCALESTTAILQQKYGLLPSHASYL
Function May regulate the activity of some transporters.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organoheterocyclic compounds
            4-Phenylpyridine Click to Show/Hide the Full List of Regulating Pair(s):   4 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (T87L; K110I) of YRDC
                      Induced Change 4-Phenylpyridine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Basal cell carcinoma [ICD-11: 2C32]
                      Details It is reported that mutation (T87L and K110I) of YRDC leads to the increase of 4-phenylpyridine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexperisson of YRDC
                      Induced Change 4-Phenylpyridine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Basal cell carcinoma [ICD-11: 2C32]
                      Details It is reported that co-overexperisson of SLC22A2 and IRIP leads to the decrease of 4-phenylpyridine levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of YRDC
                      Induced Change 4-Phenylpyridine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Basal cell carcinoma [ICD-11: 2C32]
                      Details It is reported that knockdown of YRDC leads to the increase of 4-phenylpyridine levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of YRDC
                      Induced Change 4-Phenylpyridine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Basal cell carcinoma [ICD-11: 2C32]
                      Details It is reported that overexpression of YRDC leads to the decrease of 4-phenylpyridine levels compared with control group.
References
1 IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity. Mol Cell Biol. 2005 Aug;25(15):6496-508.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.