Details of Protein
| General Information of Protein (ID: PRT00710) | |||||
|---|---|---|---|---|---|
| Name | Organic anion transporter 1 (OAT1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1; SLC22A6; OAT1; PAHT
|
||||
| Gene Name | SLC22A6 | Gene ID | |||
| UniProt ID | |||||
| Family | Organic ion transporter (OIT) | ||||
| TC Number | TC: 2.A.1.19.31 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT RQQQEHQKYMVPLQASAQEKNGL |
||||
| Function | Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS). Mediates the sodium-independent uptake of p-aminohippurate (PAH), ochratoxin (OTA), acyclovir (ACV), 3'-azido-3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS) and 3-carboxy-4-methyl-5-propyl-2-furanpropionate (CMPF), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP) and edaravone sulfate. PAH uptake is inhibited by p-chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), sulindac, diclofenac, carprofen, glutarate and okadaic acid. PAH uptake is inhibited by benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, furosemide, indomethacin, bumetamide, losartan, probenecid, phenol red, urate, and alpha-ketoglutarate. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Benzenoids | ||||||
| 4-Aminohippuric acid | Click to Show/Hide the Full List of Regulating Pair(s): 7 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (F438Y) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease (FC = 0.30) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (F438Y) of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K431R) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease (FC = 0.30) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (K431R) of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (3) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Inhibition (Furosemide) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that inhibition of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (4) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Inhibition (Indomethacin) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that inhibition of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (5) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Inhibition (Probenecid) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that inhibition of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (6) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Inhibition (Steviol) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that inhibition of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Regulating Pair (7) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Inhibition (Unlabeled Para-aminohippurate (PAH)) of SLC22A6 | |||||
| Induced Change | 4-Aminohippuric acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that inhibition of SLC22A6 leads to the decrease of 4-aminohippuric acid levels compared with control group. | |||||
| Organoheterocyclic compounds | ||||||
| Cidofovir | Click to Show/Hide the Full List of Regulating Pair(s): 6 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (F438A) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (F438A) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (F438Y) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (F438Y) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Regulating Pair (3) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K431A) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (K431A) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Regulating Pair (4) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K431R) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (K431R) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Regulating Pair (5) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (Y230A) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (Y230A) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Regulating Pair (6) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (Y230F) of SLC22A6 | |||||
| Induced Change | Cidofovir concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (Y230F) of SLC22A6 leads to the decrease of cidofovir levels compared with control group. | |||||
| Phenylpropanoids and polyketides | ||||||
| Tetracycline | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[3] | ||||
| Introduced Variation | Overexpression of SLC22A6 | |||||
| Induced Change | Tetracycline concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that overexpression of SLC22A6 leads to the increase of tetracycline levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

