Details of Protein

General Information of Protein (ID: PRT00331)
Name Transketolase-like protein 1 (TKTL1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Transketolase 2; TK 2; Transketolase-related protein; TKTL1; TKR; TKT2
Gene Name TKTL1 Gene ID
8277
UniProt ID
P51854
Family Transferases (EC 2)
EC Number   EC: 2.2.1.1  (Click to Show/Hide the Complete EC Tree)
Transferase
Transferring aldehyde or ketonic groups
Transketolases and transaldolases
EC: 2.2.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MADAEARAEFPEEARPDRGTLQVLQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVL
FFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRV
FCLMSDGESSEGSVWEAMAFASYYSLDNLVAIFDVNRLGHSGALPAEHCINIYQRRCEAF
GWNTYVVDGRDVEALCQVFWQASQVKHKPTAVVAKTFKGRGTPSIEDAESWHAKPMPRER
ADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
KLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGCASRGRTIAFA
STFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF
YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVI
GAGITVYEALAAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQG
GIGEAVCAAVSMDPDIQVHSLAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN
Function Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change ATP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of ATP levels compared with control group.
      Organic acids and derivatives
            Lactic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change Lactic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of lactic acid levels compared with control group.
            Pyruvic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change Pyruvic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of pyruvic acid levels compared with control group.
      Organic oxygen compounds
            Fructose 6-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change Fructose 6-phosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of fructose 6-phosphate levels compared with control group.
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change Glucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of glucose levels compared with control group.
            Glyceraldehyde 3-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of TKTL1
                      Induced Change Glyceraldehyde 3-phosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Head and neck squamous cell carcinoma [ICD-11: 2D60]
                      Details It is reported that overexpression of TKTL1 leads to the increase of glyceraldehyde 3-phosphate levels compared with control group.
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change TKTL1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of TKTL1 protein expression compared with control group.
References
1 TKTL1 is activated by promoter hypomethylation and contributes to head and neck squamous cell carcinoma carcinogenesis through increased aerobic glycolysis and HIF1alpha stabilization. Clin Cancer Res. 2010 Feb 1;16(3):857-66.
2 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.