Details of Protein

General Information of Protein (ID: PRT00155)
Name Arylamine N-acetyltransferase 1 (NAT1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Arylamide acetylase 1; N-acetyltransferase type 1; NAT-1; Nat1; Aac1
Gene Name Nat1 Gene ID
17960
UniProt ID
P50294
Family Transferases (EC 2)
EC Number   EC: 2.3.1.5  (Click to Show/Hide the Complete EC Tree)
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.5
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCGEAMHLDLQDIFDHIV
RKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSEMVHLLVQVTISDRKYI
VDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQIRREQYVPNEEFVNSDL
LEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSFCSLQTSEGVHCLVGSTFT
SRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVPKHGELVFTI
Function Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Isoniazid, 2-aminofluorene and anisidine are preferred substrates for NAT-1. No activity with p-aminobenzoic acid (PABA) nor SMZ.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Homogeneous non-metal compounds
            Hydrazine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Hydrazine concentration: increase (FC = 1.28)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the increase of hydrazine levels compared with control group.
      Lipids and lipid-like molecules
            Omega-3 Fatty Acids Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Omega-3 Fatty Acids concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the increase of omega-3 fatty Acids levels compared with control group.
      Organic acids and derivatives
            s-Hexylglutathione Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change s-Hexylglutathione concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Metabolic liver disease [ICD-11: 5C90]
                      Details It is reported that knockout of NAT leads to the decrease of s-hexylglutathione levels compared with control group.
      Organo heterocyclic compounds
            INH-vitamin B6 (PL) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change INH-vitamin B6 (PL) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the increase of INH-vitamin B6 (PL) levels compared with control group.
            INH-vitamin B6 (PLP) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change INH-vitamin B6 (PLP) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the increase of INH-vitamin B6 (PLP) levels compared with control group.
      Organoheterocyclic compounds
            Acetylhydrazine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Acetylhydrazine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the decrease of acetylhydrazine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Acetylhydrazine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of NAT leads to the decrease of acetylhydrazine levels compared with control group.
            Isoniazid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Isoniazid concentration: increase (FC = 1.86)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that knockout of NAT leads to the increase of isoniazid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Nat1
                      Induced Change Isoniazid concentration: increase (FC = 2.00)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that knockout of NAT leads to the increase of isoniazid levels compared with control group.
References
1 Deficiency of N-acetyltransferase increases the interactions of isoniazid with endobiotics in mouse liver. Biochem Pharmacol. 2017 Dec 1;145:218-225.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.