Details of Protein

General Information of Protein (ID: PRT01693)
Name Excitatory amino acid transporter 3 (SLC1A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Excitatory amino-acid carrier 1; Sodium-dependent glutamate/aspartate transporter 3; Solute carrier family 1 member 1; EAAC1; EAAT3
Gene Name SLC1A1 Gene ID
100009070
UniProt ID
P31597
Family Dicarboxylate/amino acid:cation symporter (DAACS)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGKPARKGCDSKRFLKNNWLLLSTVVAVVLGIVIGVLVREYSNLSTLDKFYFAFPGEILM
RMLKLVILPLIVSSMITGVAALDSNVSGKIGLRAVLYYFCTTIIAVILGIVLVVSIKPGV
TQKVDEIDRTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTTREEVTASDDTGKNGT
EESVTAVMTTAVSENRTKEYRVVGLYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMVTVLSGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMTQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDMDLSIGQIITISVTATAASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTVVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESATLDNEDSDTKKSYINGGFAVDKSDTISFTQTSQF
Function Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:1280334). Can also transport L-cysteine (By similarity). Functions as a symporter that transports one amino acid molecule together with two or three Na+ ions and one proton, in parallel with the counter-transport of one K+ ion (PubMed:1280334). Mediates Cl- flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na+ symport. Plays an important role in L-glutamate and L-aspartate reabsorption in renal tubuli (By similarity). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity). Contributes to glutathione biosynthesis and protection against oxidative stress via its role in L-glutamate and L-cysteine transport (By similarity). Negatively regulated by ARL6IP5.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Aspartic acid Click to Show/Hide the Full List of Regulating Pair(s):   5 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (D444A) of SLC1A1
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (D444A) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (D444C) of SLC1A1
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (D444C) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (D444E) of SLC1A1
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (D444E) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (D444N) of SLC1A1
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (D444N) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (D444S) of SLC1A1
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (D444S) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group.
References
1 Aspartate-444 is essential for productive substrate interactions in a neuronal glutamate transporter. J Gen Physiol. 2007 Jun;129(6):527-39.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.