Details of Protein
| General Information of Protein (ID: PRT01693) | |||||
|---|---|---|---|---|---|
| Name | Excitatory amino acid transporter 3 (SLC1A1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Excitatory amino-acid carrier 1; Sodium-dependent glutamate/aspartate transporter 3; Solute carrier family 1 member 1; EAAC1; EAAT3
|
||||
| Gene Name | SLC1A1 | Gene ID | |||
| UniProt ID | |||||
| Family | Dicarboxylate/amino acid:cation symporter (DAACS) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGKPARKGCDSKRFLKNNWLLLSTVVAVVLGIVIGVLVREYSNLSTLDKFYFAFPGEILM
RMLKLVILPLIVSSMITGVAALDSNVSGKIGLRAVLYYFCTTIIAVILGIVLVVSIKPGV TQKVDEIDRTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTTREEVTASDDTGKNGT EESVTAVMTTAVSENRTKEYRVVGLYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMVTVLSGLAIHSIVI LPLIYFIVVRKNPFRFAMGMTQALLTALMISSSSATLPVTFRCAEEKNRVDKRITRFVLP VGATINMDGTALYEAVAAVFIAQLNDMDLSIGQIITISVTATAASIGAAGVPQAGLVTMV IVLSAVGLPAEDVTLIIAVDWLLDRFRTVVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN IVNPFALESATLDNEDSDTKKSYINGGFAVDKSDTISFTQTSQF |
||||
| Function | Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:1280334). Can also transport L-cysteine (By similarity). Functions as a symporter that transports one amino acid molecule together with two or three Na+ ions and one proton, in parallel with the counter-transport of one K+ ion (PubMed:1280334). Mediates Cl- flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na+ symport. Plays an important role in L-glutamate and L-aspartate reabsorption in renal tubuli (By similarity). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity). Contributes to glutathione biosynthesis and protection against oxidative stress via its role in L-glutamate and L-cysteine transport (By similarity). Negatively regulated by ARL6IP5. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Aspartic acid | Click to Show/Hide the Full List of Regulating Pair(s): 5 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D444A) of SLC1A1 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (D444A) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D444C) of SLC1A1 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (D444C) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Regulating Pair (3) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D444E) of SLC1A1 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (D444E) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Regulating Pair (4) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D444N) of SLC1A1 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (D444N) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Regulating Pair (5) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (D444S) of SLC1A1 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (D444S) of SLC1A1 leads to the decrease of aspartic acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Aspartate-444 is essential for productive substrate interactions in a neuronal glutamate transporter. J Gen Physiol. 2007 Jun;129(6):527-39. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

