Details of Protein
| General Information of Protein (ID: PRT01609) | |||||
|---|---|---|---|---|---|
| Name | Cyclic pyranopterin monophosphate synthase (MOCS1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Mocs1
|
||||
| Gene Name | Mocs1 | Gene ID | |||
| UniProt ID | |||||
| Family | Lyases (EC 4) | ||||
| EC Number | EC: 4.1.99.22 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAARPAFGIVRQLLRSNARGCSSGAPVTQPRPGEPSRPTREGLSLRLQFLQEHAAPFSAF
LTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVD KIRLTGGEPLIRPDVVDIVARLHGLEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLD TLVPAKFEFIVRRKGFHKVMEGIHKAIELGYKPVKVNCVVMRGLNEDELLDFVALTEGLP LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQRWPGLEKLPEEDSSTAKAFKIPGFQGQ ISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLRIIGAAVG RKKRQHAGMFNIAQMKNRPMILIGVLLMLQDSPPARWSNFSWDPLRVRNPSARQCLSDQM ASLWKRHCIPKALPLSQQCLGSGSPQRHYSSYPDPDTHSKCLSTGSQAPDAPSGPGPTSN QLTHVDSAGRASMVDVGGKPETERVAVASAMVLLGPVAFKLVQQNQLKKGDALVVAQLAG VQAAKLTSQLIPLCHHVALSHVQVHLELDSTRHAVLIQASCRARGPTGVEMEALTSAAMA ALTVYDMCKAVSRDIVVTEVKLISKTGGQRGDFHRA |
||||
| Function | Isoform Mocs1a and isoform Mocs1b probably form a complex that catalyzes the conversion of 5'-GTP to cyclic pyranopterin monophosphate (cPMP). Mocs1a catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate and Mocs1b catalyzes the subsequent conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cPMP. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| Molybdopterin | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Mocs1 | |||||
| Induced Change | Molybdopterin concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Organic acid disorderss [ICD-11: 5C50] | |||||
| Details | It is reported that knockout of Mocs1 leads to the decrease of molybdopterin levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Cysteine-S-sulfate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Mocs1 | |||||
| Induced Change | Cysteine-S-sulfate concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Organic acid disorderss [ICD-11: 5C50] | |||||
| Details | It is reported that knockout of Mocs1 leads to the increase of cysteine-S-sulfate levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The pathogenesis of molybdenum cofactor deficiency, its delay by maternal clearance, and its expression pattern in microarray analysis. Mol Genet Metab. 2005 May;85(1):12-20. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

