Details of Protein
General Information of Protein (ID: PRT01609) | |||||
---|---|---|---|---|---|
Name | Cyclic pyranopterin monophosphate synthase (MOCS1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Mocs1
|
||||
Gene Name | Mocs1 | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.1.99.22 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAARPAFGIVRQLLRSNARGCSSGAPVTQPRPGEPSRPTREGLSLRLQFLQEHAAPFSAF
LTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVD KIRLTGGEPLIRPDVVDIVARLHGLEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLD TLVPAKFEFIVRRKGFHKVMEGIHKAIELGYKPVKVNCVVMRGLNEDELLDFVALTEGLP LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQRWPGLEKLPEEDSSTAKAFKIPGFQGQ ISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLRIIGAAVG RKKRQHAGMFNIAQMKNRPMILIGVLLMLQDSPPARWSNFSWDPLRVRNPSARQCLSDQM ASLWKRHCIPKALPLSQQCLGSGSPQRHYSSYPDPDTHSKCLSTGSQAPDAPSGPGPTSN QLTHVDSAGRASMVDVGGKPETERVAVASAMVLLGPVAFKLVQQNQLKKGDALVVAQLAG VQAAKLTSQLIPLCHHVALSHVQVHLELDSTRHAVLIQASCRARGPTGVEMEALTSAAMA ALTVYDMCKAVSRDIVVTEVKLISKTGGQRGDFHRA |
||||
Function | Isoform Mocs1a and isoform Mocs1b probably form a complex that catalyzes the conversion of 5'-GTP to cyclic pyranopterin monophosphate (cPMP). Mocs1a catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate and Mocs1b catalyzes the subsequent conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cPMP. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Nucleosides, nucleotides, and analogues | ||||||
Molybdopterin | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Mocs1 | |||||
Induced Change | Molybdopterin concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Organic acid disorderss [ICD-11: 5C50] | |||||
Details | It is reported that knockout of Mocs1 leads to the decrease of molybdopterin levels compared with control group. | |||||
Organic acids and derivatives | ||||||
Cysteine-S-sulfate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Mocs1 | |||||
Induced Change | Cysteine-S-sulfate concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Organic acid disorderss [ICD-11: 5C50] | |||||
Details | It is reported that knockout of Mocs1 leads to the increase of cysteine-S-sulfate levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | The pathogenesis of molybdenum cofactor deficiency, its delay by maternal clearance, and its expression pattern in microarray analysis. Mol Genet Metab. 2005 May;85(1):12-20. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.