Details of Protein
General Information of Protein (ID: PRT01601) | |||||
---|---|---|---|---|---|
Name | N-acylneuraminate-9-phosphatase (NANP) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Haloacid dehalogenase-like hydrolase domain-containing protein 4; Neu5Ac-9-Pase; NANP; C20orf147; HDHD4
|
||||
Gene Name | NANP | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.1.3.29 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKEC
FHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTE LRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQ PGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSI DCKVSMST |
||||
Structure | |||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Nucleosides, nucleotides, and analogues | ||||||
CMP-N-Acetylneuraminate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of NANP | |||||
Induced Change | CMP-N-Acetylneuraminate concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Carbohydrate metabolism disorders [ICD-11: 5C51] | |||||
Details | It is reported that knockout of NANP leads to the decrease of CMP-N-acetylneuraminate levels compared with control group. | |||||
Organic oxygen compounds | ||||||
N-Acetylneuraminic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of NANP | |||||
Induced Change | N-Acetylneuraminic acid concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Carbohydrate metabolism disorders [ICD-11: 5C51] | |||||
Details | It is reported that knockout of NANP leads to the decrease of N-acetylneuraminic acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Activity of N-acylneuraminate-9-phosphatase (NANP) is not essential for de novo sialic acid biosynthesis. Biochim Biophys Acta Gen Subj. 2019 Oct;1863(10):1471-1479. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.