Details of Protein

General Information of Protein (ID: PRT01600)
Name Glycerol-3-phosphate phosphatase (PGP)
Synonyms   Click to Show/Hide Synonyms of This Protein
G3PP; Aspartate-based ubiquitous Mg(2+)-dependent phosphatase; AUM; Phosphoglycolate phosphatase; PGP; PGP
Gene Name PGP Gene ID
283871
UniProt ID
A6NDG6
Family Hydrolases (EC 3)
EC Number   EC: 3.1.3.21  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.21
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARG
KRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPK
AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMK
LTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
KKMVPDFYVDSIADLLPALQG
Function Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphoglycolate phosphatase activity and a tyrosine-protein phosphatase activity. However, their physiological relevance is unclear. In vitro, has also a phosphatase activity toward ADP, ATP, GDP and GTP.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            TG(19:0/19:0/22:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of PGP
                      Induced Change TG(19:0/19:0/22:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of PGP leads to the increase of TG(19:0/19:0/22:0) levels compared with control group.
      Organic oxygen compounds
            3-Phosphoglyceric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of PGP
                      Induced Change 3-Phosphoglyceric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of PGP leads to the increase of 3-phosphoglyceric acid levels compared with control group.
References
1 A phosphoglycolate phosphatase/AUM-dependent link between triacylglycerol turnover and epidermal growth factor signaling. Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Jun;1863(6):584-594.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.