Details of Protein

General Information of Protein (ID: PRT01221)
Name Glucose transporter type 8 (GLUT-8)
Synonyms   Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 8; Glucose transporter type X1; Slc2a8; Glut8; GlutX1
Gene Name Slc2a8 Gene ID
56017
UniProt ID
Q9JIF3
Family Sugar transporter (ST)
TC Number   TC: 2.A.1.1.46  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Sugar Porter (SP) Family
TC: 2.A.1.1.46
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSPEDPQETQPLLRPPEARTPRGRRVFLASFAAALGPLSFGFALGYSSPAIPSLRRTAPP
ALRLGDNAASWFGAVVTLGAAAGGILGGWLLDRAGRKLSLLLCTVPFVTGFAVITAARDV
WMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVTGILLAYVAGWVLE
WRWLAVLGCVPPTLMLLLMCYMPETPRFLLTQHQYQEAMAALRFLWGSEEGWEEPPVGAE
HQGFQLALLRRPGIYKPLIIGISLMVFQQLSGVNAIMFYANSIFEEAKFKDSSLASVTVG
IIQVLFTAVAALIMDRAGRRLLLALSGVIMVFSMSAFGTYFKLTQSLPSNSSHVGLVPIA
AEPVDVQVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWFM
AFLVTKEFSSVMEMLRPYGAFWLTAAFCALSVLFTLTVVPETKGRTLEQVTAHFEGR
Function Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose. Also able to mediate the transport of dehydroascorbate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            2-Deoxyglucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (di-leucine to di-alanine substitution (LL-AA)) of Slc2a8
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (di-leucine to di-alanine substitution (LL-AA)) of Slc2a8 leads to the increase of 2-deoxyglucose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc2a8
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc2a8 leads to the increase of 2-deoxyglucose levels compared with control group.
      Organic oxygen compounds
            Dihydroartemisinin Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (di-leucine to di-alanine substitution (LL-AA)) of Slc2a8
                      Induced Change Dihydroartemisinin concentration: increase (FC = 5 - 10)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (di-leucine to di-alanine substitution (LL-AA)) of Slc2a8 leads to the increase of dihydroartemisinin levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc2a8
                      Induced Change Dihydroartemisinin concentration: increase (FC = 5 - 10)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc2a8 leads to the increase of dihydroartemisinin levels compared with control group.
References
1 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8. J Biol Chem. 2013 Mar 29;288(13):9092-101.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.