Details of Protein

General Information of Protein (ID: PRT01206)
Name Interferon regulatory factor 3 (IRF3)
Synonyms   Click to Show/Hide Synonyms of This Protein
IRF-3; IRF3
Gene Name IRF3 Gene ID
3661
UniProt ID
Q14653
Family Transcription factor (TF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES
Structure
1J2F ; 1QWT ; 1T2K ; 1ZOQ ; 2O61 ; 2O6G ; 2PI0 ; 3A77 ; 3QU6 ; 5JEJ ; 5JEK ; 5JEL ; 5JEM ; 5JEO ; 5JER ; 6SIV ; 6SJA ; 7JFL
Function Key transcriptional regulator of type I interferon (IFN)-dependent immune responses which plays a critical role in the innate immune response against DNA and RNA viruses. Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. Acts as a more potent activator of the IFN-beta (IFNB) gene than the IFN-alpha (IFNA) gene and plays a critical role in both the early and late phases of the IFNA/B gene induction. Found in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, is phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. Can activate distinct gene expression programs in macrophages and can induce significant apoptosis in primary macrophages. In response to Sendai virus infection, is recruited by TOMM70:HSP90AA1 to mitochondrion and forms an apoptosis complex TOMM70:HSP90AA1:IRF3:BAX inducing apoptosis. Key transcription factor regulating the IFN response during SARS-CoV-2 infection.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids
            Sodium oxamate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Sodium oxamate addition (12 hours)
                      Induced Change IRF3 protein phosphorylation levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that sodium oxamate addition causes the increase of IRF3 protein phosphorylation compared with control group.
References
1 Lactate Is a Natural Suppressor of RLR Signaling by Targeting MAVS. Cell. 2019 Jun 27;178(1):176-189.e15.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.