Details of Protein
| General Information of Protein (ID: PRT01177) | |||||
|---|---|---|---|---|---|
| Name | Sialin (HP59) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular H(+)/Aspartate-glutamate cotransporter; SLC17A5
|
||||
| Gene Name | SLC17A5 | Gene ID | |||
| UniProt ID | |||||
| Family | Sodium/anion cotransporter (SAC) | ||||
| TC Number | TC: 2.A.1.14.10 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNL
SVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYI ITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFP AMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFW FLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFS YNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFST LCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPS YAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKG EVQNWALNDHHGHRH |
||||
| Function | Transports glucuronic acid and free sialic acid out of the lysosome after it is cleaved from sialoglycoconjugates undergoing degradation, this is required for normal CNS myelination. Mediates aspartate and glutamate membrane potential-dependent uptake into synaptic vesicles and synaptic-like microvesicles. Also functions as an electrogenic 2NO(3)(-)/H(+) cotransporter in the plasma membrane of salivary gland acinar cells, mediating the physiological nitrate efflux, 25% of the circulating nitrate ions is typically removed and secreted in saliva. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Aspartic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K136E) of SLC17A5 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (K136E) of SLC17A5 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (R39C) of SLC17A5 | |||||
| Induced Change | Aspartic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (R39C) of SLC17A5 leads to the decrease of aspartic acid levels compared with control group. | |||||
| Glutamic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K136E) of SLC17A5 | |||||
| Induced Change | Glutamic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (K136E) of SLC17A5 leads to the decrease of glutamic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (R39C) of SLC17A5 | |||||
| Induced Change | Glutamic acid concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (R39C) of SLC17A5 leads to the decrease of glutamic acid levels compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Neuraminic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (K136E) of SLC17A5 | |||||
| Induced Change | Neuraminic acid concentration: decrease (FC = 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (K136E) of SLC17A5 leads to the decrease of neuraminic acid levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (R39C) of SLC17A5 | |||||
| Induced Change | Neuraminic acid concentration: decrease (FC = 0.68) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lysosomal storage diseases [ICD-11: 5C56] | |||||
| Details | It is reported that mutation (R39C) of SLC17A5 leads to the decrease of neuraminic acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Functional characterization of vesicular excitatory amino acid transport by human sialin. J Neurochem. 2011 Oct;119(1):1-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

