Details of Protein

General Information of Protein (ID: PRT01152)
Name Neurotransmitter transporter NTT4 (SLC6A17)
Synonyms   Click to Show/Hide Synonyms of This Protein
Sodium-dependent neurotransmitter transporter NTT4; Solute carrier family 6 member 17; Slc6a17; Ntt4; Rxt1
Gene Name Slc6a17 Gene ID
613226
UniProt ID
P31662
Family Sodium:neurotransmitter symporter (SNF)
TC Number   TC: 2.A.22.6.2  (Click to Show/Hide the Complete TC Tree)
The Neurotransmitter:Sodium Symporter (NSS) Family
.
TC: 2.A.22.6.2
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPKNSKVTQREHSNEHVTESVADLLALEEPVDYKQSVLNVAGETGGKQKVAEEELDAEDR
PAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAV
GQRIRRGSIGVWHYVCPRLGGIGFSSCIVCLFVGLYYNVIIGWSVFYFFKSFQYPLPWSE
CPVIRNGTVAVVEPECEKSSATTYFWYREALDISNSISESGGLNWKMTVCLLVAWSIVGM
AVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWRE
AATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKAN
IMNEKCVVENAEKILGYLNSNVLSRDLIPPHVNFSHLTTKDYSEMYNVIMTVKEKQFSAL
GLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAG
ITTPIIDTFKVPKEMFTVGCCVFAFFVGLLFVQRSGNYFVTMFDDYSATLPLTVIVILEN
IAVAWIYGTKKFMQELTEMLGFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVSPPGYSA
WIKEEAAERYLYFPNWAMALLITLIAVATLPIPVVFILRHFHLLSDGSNTLSVSYKKGRM
MKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLESSSHPNGRYGSGYLLA
STPESEL
Function Functions as a sodium-dependent vesicular transporter selective for proline, glycine, leucine and alanine. In contrast to other members of this neurotransmitter transporter family, does not appear to be chloride-dependent.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Alanine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Slc6a17
                      Induced Change Alanine concentration: decrease (FC = 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc6a17 leads to the decrease of alanine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc6a17
                      Induced Change Alanine concentration: increase (FC = 2.06)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc6a17 leads to the increase of alanine levels compared with control group.
            Glycine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Slc6a17
                      Induced Change Glycine concentration: decrease (FC = 0.30)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc6a17 leads to the decrease of glycine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc6a17
                      Induced Change Glycine concentration: increase (FC = 6.11)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc6a17 leads to the increase of glycine levels compared with control group.
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Slc6a17
                      Induced Change Leucine concentration: decrease (FC = 0.30)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc6a17 leads to the decrease of leucine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc6a17
                      Induced Change Leucine concentration: increase (FC = 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc6a17 leads to the increase of leucine levels compared with control group.
            Proline Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Slc6a17
                      Induced Change Proline concentration: decrease (FC = 0.30)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc6a17 leads to the decrease of proline levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Slc6a17
                      Induced Change Proline concentration: increase (FC = 104.92)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc6a17 leads to the increase of proline levels compared with control group.
References
1 The orphan transporter Rxt1/NTT4 (SLC6A17) functions as a synaptic vesicle amino acid transporter selective for proline, glycine, leucine, and alanine. Mol Pharmacol. 2008 Dec;74(6):1521-32.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.