Details of Protein
| General Information of Protein (ID: PRT01149) | |||||
|---|---|---|---|---|---|
| Name | Pyruvate kinase M2 (PKM) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Pyruvate kinase muscle isozyme; Pkm; Pk3; Pkm2; Pykm
|
||||
| Gene Name | Pkm | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.7.1.40 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEM
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIR TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL ISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLN AWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP |
||||
| Function | Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. The ratio between the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production. The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival. In addition to its role in glycolysis, also regulates transcription. Stimulates POU5F1-mediated transcriptional activation. Promotes in a STAT1-dependent manner, the expression of the immune checkpoint protein CD274 in ARNTL/BMAL1-deficient macrophages. Also acts as a translation regulator for a subset of mRNAs, independently of its pyruvate kinase activity: associates with subpools of endoplasmic reticulum-associated ribosomes, binds directly to the mRNAs translated at the endoplasmic reticulum and promotes translation of these endoplasmic reticulum-destined mRNAs. Plays a general role in caspase independent cell death of tumor cells. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids | ||||||
| Pyruvate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of Pkm | |||||
| Induced Change | Pyruvate concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lung cancer [ICD-11: 2C25] | |||||
| Details | It is reported that knockdown of Pkm leads to the increase of pyruvate levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Lactic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of Pkm | |||||
| Induced Change | Lactic acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lung cancer [ICD-11: 2C25] | |||||
| Details | It is reported that knockdown of Pkm leads to the increase of lactic acid levels compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Fructose-bisphosphate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of Pkm | |||||
| Induced Change | Fructose-bisphosphate concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Lung cancer [ICD-11: 2C25] | |||||
| Details | It is reported that knockdown of Pkm leads to the decrease of fructose-bisphosphate levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The M2 splice isoform of pyruvate kinase is important for cancer metabolism and tumour growth. Nature. 2008 Mar 13;452(7184):230-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

