Details of Protein

General Information of Protein (ID: PRT01071)
Name S1P receptor 1 (S1PR1)
Synonyms   Click to Show/Hide Synonyms of This Protein
S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363; S1PR1; CHEDG1; EDG1
Gene Name S1PR1 Gene ID
1901
UniProt ID
P21453
Family GPCR rhodopsin (GPCR-1)
TC Number   TC: 9.A.14.2.1  (Click to Show/Hide the Complete TC Tree)
The G-protein-coupled receptor (GPCR) Family
.
TC: 9.A.14.2.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Structure
3V2W ; 3V2Y
Function G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Lipids and lipid-like molecules
            Sphingosine 1-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Sphingosine 1-phosphate addition (0.08 hours)
                      Induced Change S1PR1 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that sphingosine 1-phosphate addition causes the increase of S1PR1 protein activity compared with control group.
References
1 Amiselimod (MT-1303), a novel sphingosine 1-phosphate receptor-1 functional antagonist, inhibits progress of chronic colitis induced by transfer of CD4+CD45RBhigh T cells. PLoS One. 2019 Dec 5;14(12):e0226154.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.