Details of Protein

General Information of Protein (ID: PRT01035)
Name Glycerophosphodiester phosphodiesterase 1 (GDE1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Glycerophosphoinositol glycerophosphodiesterase GDE1; Lysophospholipase D GDE1; Membrane-interacting protein of RGS16; Gde1; Mir16
Gene Name Gde1 Gene ID
56209
UniProt ID
Q9JL56
Family Hydrolases (EC 3)
EC Number   EC: 3.1.4.44  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Phosphoric diester hydrolase
EC: 3.1.4.44
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MWLWEDQGGLLGPFSFVLVLLLVVTRSPFNACVLTGSLYILLRFFSFEPVPSRRALQVLK
PRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTT
DGSGRLCDLTFEQVRKLNPAANHRLRNEFPDERIPTLKEAVTECLRHNLTIFFDVKGHAD
MASAALKNIYTEFPQLYNNSMVCSFLPEVIYKMRQTDQKVITALTHRPWSLSHTGDGKPR
YSVFWKQSVFVVLDILLDWSMHNVLWYLCGISAFLMQKDFVSPDYLKKWSAKGIQVVSWT
VNTFDEKNYYESHLGSSYITDSMLEDCAPHF
Function Hydrolyzes the phosphodiester bond of glycerophosphodiesters such as glycerophosphoinositol (GroPIns) and glycerophosphoethanolamine (GroPEth), to yield a glycerol phosphate and an alcohol. Hydrolyzes glycerophospho-N-acylethanolamines to N-acylethanolamines in the brain and partipates to bioactive N-acylethanolamines biosynthesis such as anandamide (an endocannabinoid), N-palmitoylethanolamine (an anti-inflammatory), and N-oleoylethanolamine (an anorexic). In addition, has a lysophospholipase D activity by hydrolyzing N-acyl-lysoplasmenylethanolamine (N-acyl-lysoPlsEt) to N-acylethanolamine. However lysophospholipase D activity is lower than glycerophosphodiester phosphodiesterase activity. Has little or no activity towards glycerophosphocholine.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            Glycerophosphoinositol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Gde1
                      Induced Change Glycerophosphoinositol concentration: increase (FC = 25)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Gde1 leads to the increase of glycerophosphoinositol levels compared with control group.
            PS(18:1(11Z)/16:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Gde1
                      Induced Change PS(18:1(11Z)/16:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Gde1 leads to the increase of PS(18:1(11Z)/16:0) levels compared with control group.
      Organic acids and derivatives
            D-Serine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Gde1
                      Induced Change D-Serine concentration: decrease (FC= 1.6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Gde1 leads to the decrease of D-Serine levels compared with control group.
            Serine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Gde1
                      Induced Change Serine concentration: decrease (FC= 1.6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Gde1 leads to the decrease of serine levels compared with control group.
      Organic oxygen compounds
            Glycerophosphoglycerate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Gde1
                      Induced Change Glycerophosphoglycerate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Gde1 leads to the increase of glycerophosphoglycerate levels compared with control group.
References
1 The glycerophospho metabolome and its influence on amino acid homeostasis revealed by brain metabolomics of GDE1(-/-) mice. Chem Biol. 2010 Aug 27;17(8):831-40.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.