Details of Protein

General Information of Protein (ID: PRT01034)
Name Equilibrative nucleoside transporter 2 (SLC29A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
36 kDa nucleolar protein HNP36; Delayed-early response protein 12; Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter; Equilibrative NBMPR-insensitive nucleoside transporter; Hydrophobic nucleolar protein, 36 kDa; Nucleoside transporter, ei-type; Solute carrier family 29 member 2; SLC29A2; DER12; ENT2; HNP36
Gene Name SLC29A2 Gene ID
3177
UniProt ID
Q14542
Family Equilibrative nucleoside transporter (ENT)
TC Number   TC: 2.A.57.1.8  (Click to Show/Hide the Complete TC Tree)
The Equilibrative Nucleoside Transporter (ENT) Family
.
TC: 2.A.57.1.8
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTG
PEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVD
MSPGPFFSITMASVCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLL
SMASGVDAETSALGYFITPCVGILMSIVCYLSLPHLKFARYYLANKSSQAQAQELETKAE
LLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLV
FTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSYFLWPDEDSRL
LPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
Function Mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. Very less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            Adenosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC29A2
                      Induced Change Adenosine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC29A2 leads to the increase of adenosine levels compared with control group.
            Uridine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Nitrobenzylthioinosine (NBMPR)) of SLC29A2
                      Induced Change Uridine concentration: decrease (FC = 0.15)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC29A2 leads to the decrease of uridine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC29A2
                      Induced Change Uridine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC29A2 leads to the increase of uridine levels compared with control group.
References
1 Molecular cloning and characterization of a nitrobenzylthioinosine-insensitive (ei) equilibrative nucleoside transporter from human placenta. Biochem J. 1997 Dec 15;328 ( Pt 3)(Pt 3):739-43.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.