Details of Protein

General Information of Protein (ID: PRT01022)
Name Solute carrier family 15 member 3 (SLC15A3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Osteoclast transporter; Peptide transporter 3; Peptide/histidine transporter 2; SLC15A3; OCTP; PHT2; PTR3
Gene Name SLC15A3 Gene ID
51296
UniProt ID
Q8IY34
Family Proton-dependent oligopeptide transporter (POT/PTR)
TC Number   TC: 2.A.17.3.9  (Click to Show/Hide the Complete TC Tree)
The Proton-dependent Oligopeptide Transporter (POT/PTR) Family
.
TC: 2.A.17.3.9
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYL
NSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPA
TAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLT
SFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLA
FFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPG
ASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVA
LRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGL
EFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDL
YFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG
Function Proton-coupled amino-acid transporter that transports free histidine and certain di- and tripeptides, and is involved in innate immune response. Also able to transport carnosine. Involved in the detection of microbial pathogens by toll-like receptors (TLRs) and NOD-like receptors (NLRs), probably by mediating transport of bacterial peptidoglycans across the endolysosomal membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Carnosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of SLC15A3
                      Induced Change Carnosine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Brain cancer [ICD-11: 2A00]
                      Details It is reported that knockdown of SLC15A3 leads to the decrease of carnosine levels compared with control group.
            Histidine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Recombinant protein addition of SLC15A3
                      Induced Change Histidine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that recombinant protein addition of SLC15A3 leads to the decrease of histidine levels compared with control group.
References
1 The proton-coupled oligopeptide transporters PEPT2, PHT1 and PHT2 mediate the uptake of carnosine in glioblastoma cells. Amino Acids. 2019 Jul;51(7):999-1008.
2 Cloning of a lymphatic peptide/histidine transporter. Biochem J. 2001 May 15;356(Pt 1):53-60.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.