Details of Protein

General Information of Protein (ID: PRT00979)
Name Neuropeptide Y (NPY)
Synonyms   Click to Show/Hide Synonyms of This Protein
Npy
Gene Name Npy Gene ID
100912228
UniProt ID
P07808
Family Neuropeptide Y (NPY)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
Function NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            3,4-Dihydroxybenzeneacetic acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Antagonist ([D-Trp32]NPY) of Npy
                      Induced Change 3,4-Dihydroxybenzeneacetic acid concentration: increase (FC = 1.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that Antagonist ([D-Trp32]NPY) of Npy leads to the increase of 3,4-dihydroxybenzeneacetic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Npy
                      Induced Change 3,4-Dihydroxybenzeneacetic acid concentration: increase (FC = 2.00)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Npy leads to the increase of 3,4-dihydroxybenzeneacetic acid levels compared with control group.
            Homovanillic acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Antagonist ([D-Trp32]NPY) of Npy
                      Induced Change Homovanillic acid concentration: increase (FC = 2.20)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that antagonist [D-Trp32]NPY of Npy leads to the increase of homovanillic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Npy
                      Induced Change Homovanillic acid concentration: increase (FC = 3.00)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Npy leads to the increase of homovanillic acid levels compared with control group.
            Norepinephrine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Antagonist ([D-Trp32]NPY) of Npy
                      Induced Change Norepinephrine concentration: increase (FC = 1.70)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that antagonist [D-Trp32]NPY of Npy leads to the increase of norepinephrine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Npy
                      Induced Change Norepinephrine concentration: increase (FC = 1.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Npy leads to the increase of norepinephrine levels compared with control group.
      Organoheterocyclic compounds
            Thiamine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Antagonist ([D-Trp32]NPY) of Npy
                      Induced Change Thiamine concentration: increase (FC = 2.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that antagonist [D-Trp32]NPY of Npy leads to the increase of thiamine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Npy
                      Induced Change Thiamine concentration: increase (FC = 2.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Npy leads to the increase of thiamine levels compared with control group.
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Leucine addition (504 hours)
                      Induced Change NPY mRNA levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Stomach cancer [ICD-11: 2B72]
                      Details It is reported that leucine addition causes the decrease of NPY mRNA levels compared with control group.
References
1 Effects of neuropeptide Y (NPY) and [D-Trp32]NPY on monoamine and metabolite levels in dialysates from rat hypothalamus during feeding behavior. Neuropeptides. 1996 Aug;30(4):391-8.
2 Dietary l-leucine supplementation of lactating rats results in a tendency to increase lean/fat ratio associated to lower orexigenic neuropeptide expression in hypothalamus. Peptides. 2010 Jul;31(7):1361-7.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.